KEGG   Rattus norvegicus (rat): 24377
Entry
24377             CDS       T01003                                 

Gene name
G6pd
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00030  Pentose phosphate pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno05230  Central carbon metabolism in cancer
rno05415  Diabetic cardiomyopathy
Module
rno_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rno_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    24377 (G6pd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24377 (G6pd)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    24377 (G6pd)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    24377 (G6pd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24377 (G6pd)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     24377 (G6pd)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     24377 (G6pd)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   24377 (G6pd)
  Exosomal proteins of colorectal cancer cells
   24377 (G6pd)
  Exosomal proteins of bladder cancer cells
   24377 (G6pd)
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 24377
NCBI-ProteinID: NP_058702
RGD: 2645
Ensembl: ENSRNOG00000056728
UniProt: P05370
Position
X
AA seq 515 aa
MAEQVALSRTQVCGILREELYQGDAFHQADTHIFIIMGASGDLAKKKIYPTIWWLFRDGL
LPEDTFIVGYARSRLTVDDIRKQSEPFFKVTPEERPKLEEFFARNSYVAGQYDDPASYKH
LNSHMNALHQGMQANRLFYLALPPTVYEAVTKNIQEICMSQTGWNRIIVEKPFGRDLQSS
NQLSNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEP
FGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTDSDDVRDEKVKVLKCISEVET
DNVVLGQYVGNPSGEGEATNGYLDDPTVPHGSTTATFAAAVLYVENERWDGVPFILRCGK
ALNERKAEVRLQFRDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL
DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHKIDREKPQPI
PYVYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcagagcaggtggctttgagccggacccaggtgtgtgggatcctgagggaagagttg
taccagggtgatgccttccaccaagctgatacacacatatttatcatcatgggtgcatcg
ggtgacctggccaagaagaagatttatcctaccatctggtggctgttccgggatggcctt
ctacccgaagacaccttcattgtaggctatgcccgctcacgactcacagtggatgacatc
cgcaaacagagtgagcccttctttaaagtcactccagaagaaagacccaagctagaggag
ttctttgcccgtaactcctatgtagctggccagtatgatgatccagcctcctacaagcac
ctcaacagccacatgaatgccctgcaccagggaatgcaggccaaccgtctgttctacctg
gccttgccccccactgtctatgaagcagtcaccaagaacattcaagagatctgcatgagt
cagacaggctggaaccgcatcatagtggagaagcccttcgggagagacctgcagagctcc
aatcaactgtcgaaccacatctcctctctgtttcgtgaggaccagatctaccgcattgac
cactacctgggcaaagagatggtccagaacctcatggtgctgagatttgccaacaggatc
tttggacccatctggaatcgagacaacattgcttgtgtgatccttacatttaaagagccc
tttggtactgagggtcgtgggggctattttgatgaatttgggatcatcagggatgtcatg
cagaaccacctcctgcagatgttgtgtctagtggccatggaaaagcctgcctctacagat
tcagatgatgtccgtgatgagaaggtcaaagtgttaaaatgtatctcagaggtggaaact
gacaacgtggtccttggccagtatgtggggaaccccagtggagaaggagaagctaccaat
gggtacttagatgaccccacagtaccccatgggtctaccactgctacctttgcagcagct
gtcctctatgtggagaatgaacggtgggatggagtacccttcatcctgcgctgtggcaaa
gctctgaatgagcgcaaagctgaagtgagacttcagttccgcgatgtggcaggtgacatc
ttccaccagcagtgcaagcgtaacgagctggtcatccgtgtgcagcccaatgaggcggta
tacaccaagatgatgaccaagaagcctggcatgttcttcaaccctgaggagtctgagctg
gacctaacctatggcaacagatacaagaatgtgaagctccctgatgcctatgaacgcctc
atcctggatgtcttctgtgggagccaaatgcactttgtccgtagtgatgaactcagggaa
gcctggcgtatcttcacaccattgctgcacaagattgatcgagagaagccccagcccatc
ccgtatgtctatggcagccgaggtcccacagaggcagatgagctgatgaagagagtgggc
ttccagtatgagggtacctacaagtgggtgaaccctcacaagctctga

DBGET integrated database retrieval system