KEGG   Rattus norvegicus (rat): 24387Help
Entry
24387             CDS       T01003                                 

Gene name
Gfap
Definition
(RefSeq) glial fibrillary acidic protein
  KO
K05640  glial fibrillary acidic protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    24387 (Gfap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24387 (Gfap)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24387 (Gfap)
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    24387 (Gfap)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     24387 (Gfap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament Filament_head DUF1664 Spc7 Jnk-SapK_ap_N GAS T6PP_N DUF4407
Motif
Other DBs
NCBI-GeneID: 24387
NCBI-ProteinID: NP_058705
RGD: 2679
Ensembl: ENSRNOG00000002919
UniProt: P47819
Position
10q32.1
AA seq 430 aa AA seqDB search
MERRRITSARRSYASSETMVRGHGPTRHLGTIPRLSLSRMTPPLPARVDFSLAGALNAGF
KETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELRE
LRLRLDQLTTNSARLEVERDNLTQDLGTLRQKLQDETNLRLEAENNLAVYRQEADEATLA
RVDLERKVESLEEEIQFLRKIHEEEVRELQEQLAQQQVHVEMDVAKPDLTAALREIRTQY
EAVATSNMQETEEWYRSKFADLTDVASRNAELLRQAKHEANDYRRQLQALTCDLESLRGT
NESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIE
IATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIK
ESKQEHKDVM
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggagcggagacgtatcacctctgcacgccgctcctatgcctcctccgagacgatggtc
aggggccatggtcctaccagacacctgggtaccattccgcgcctctccctgtctcgaatg
acgcctccactccctgccagggtagacttctccctggccggggcgctcaatgccggcttc
aaagagactcgggccagcgagcgtgcggagatgatggagctcaatgaccgctttgctagc
tacatcgagaaggtccgcttcctggaacagcaaaacaaggcgctggcagctgagctgaac
cagcttcgagccaaggagcccaccaaactggctgacgtttaccaggcagaacttcgggag
ctgcggctgcgtctggaccagcttactaccaacagtgcccggctggaggtggagagggac
aatctcacacaggacctcggcaccctgaggcagaagctccaagatgaaaccaacctgagg
ctggaggcggagaacaacctggctgtgtacagacaggaggcggatgaagccaccttggct
cgtgtggatctggagaggaaggttgagtcgctggaggaggagatccagttcttgaggaag
atccatgaggaggaagttcgagaactccaggagcagctggcccagcagcaggtccacgtg
gagatggatgtggccaagccagacctcacagcggctctgagagagattcgcactcagtac
gaggcagtggccaccagtaacatgcaagaaacagaagagtggtatcggtccaagtttgca
gacctcacagacgttgcttcccgcaacgcagagctgctccgccaggccaagcacgaggct
aatgactatcgccgccaactgcaggccttgacctgcgaccttgagtccttgcgcggcacg
aacgagtccttggagaggcaaatgcgcgaacaggaggagcgccacgcgcgggagtcggcg
agttaccaggaggcactcgctcggctggaggaggagggccaaagcctcaaggaggagatg
gcccgccacctgcaggagtaccaggatctactcaacgttaagctagccctggacatcgag
atcgccacctacaggaaattgctggagggcgaagaaaaccgcatcaccattcctgtacag
actttctccaacctccagatccgagaaaccagcctggacaccaaatctgtgtcagaaggc
cacctcaagaggaacatcgtggtaaagacggtggagatgcgggatggcgaggtcattaag
gagtcgaagcaggagcacaaggatgtgatgtga

DBGET integrated database retrieval system