KEGG   Rattus norvegicus (rat): 24391
Entry
24391             CDS       T01003                                 

Gene name
Gh1, Gh, Ghb1, RNGHGP
Definition
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04630  JAK-STAT signaling pathway
rno04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24391 (Gh1)
   04151 PI3K-Akt signaling pathway
    24391 (Gh1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24391 (Gh1)
   04060 Cytokine-cytokine receptor interaction
    24391 (Gh1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    24391 (Gh1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24391 (Gh1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  CSF and other factors
   24391 (Gh1)
SSDB
Motif
Pfam: Hormone_1 DUF5798
Other DBs
NCBI-GeneID: 24391
NCBI-ProteinID: NP_001030020
RGD: 2686
Ensembl: ENSRNOG00000011207
UniProt: P01244 B2RYR2
Position
10q32.1
AA seq 216 aa
MAADSQTPWLLTFSLLCLLWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERA
YIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSR
IFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDAL
LKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
NT seq 651 nt   +upstreamnt  +downstreamnt
atggctgcagactctcagactccctggctcctgaccttcagcctgctctgcctgctgtgg
cctcaagaggctggtgctttccctgccatgcccttgtccagtctgtttgccaatgctgtg
ctccgagcccagcacctgcaccagctggctgctgacacctacaaagagttcgagcgtgcc
tacattcccgagggacagcgctattccattcagaatgcccaggctgcgttctgcttctca
gagaccatcccagcccccaccggcaaggaggaggcccagcagagaactgacatggaattg
cttcgcttctcgctgctgctcatccagtcatggctggggcccgtgcagtttctcagcagg
atctttaccaacagcctgatgtttggtacctcggaccgcgtctatgagaaactgaaggac
ctggaagagggcatccaggctctgatgcaggagctggaagacggcagcccccgtattggg
cagatcctcaagcaaacctatgacaagtttgacgccaacatgcgcagcgatgacgctctg
ctcaaaaactatgggctgctctcctgcttcaagaaggacctgcacaaggcagagacctac
ctgcgggtcatgaagtgtcgccgctttgcggaaagcagctgtgctttctag

DBGET integrated database retrieval system