KEGG   Rattus norvegicus (rat): 24392Help
Entry
24392             CDS       T01003                                 

Gene name
Gja1, Cx43
Definition
(RefSeq) gap junction protein, alpha 1
  KO
K07372  gap junction alpha-1 protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04540  Gap junction
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24392 (Gja1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    24392 (Gja1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24392 (Gja1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24392 (Gja1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin Connexin43 Connexin40_C Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 24392
NCBI-ProteinID: NP_036699
RGD: 2690
Ensembl: ENSRNOG00000000805
UniProt: P08050
Structure
PDB: 

Position
20q11
AA seq 382 aa AA seqDB search
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPG
CENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDG
VNVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFS
LSAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRV
KGRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVD
QRPSSRASSRASSRPRPDDLEI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactggagtgccttggggaagcttctggacaaggtccaagcctactccaccgct
ggagggaaggtgtggctgtcagtgctcttcatattcagaatcctgctcctggggacagct
gttgagtcagcttggggtgatgaacagtctgcctttcgctgtaacactcaacaacctggc
tgcgaaaacgtctgctatgacaagtccttccccatctctcacgtgcgcttctgggtcctt
cagatcatattcgtgtctgtgcccaccctcctgtacttggcccatgtgttctatgtgatg
aggaaggaagagaagctaaacaagaaagaagaggagctcaaagtggcccagactgacggg
gtcaacgtggagatgcacctgaagcagattgaaatcaagaagttcaagtacgggattgaa
gagcacggcaaggtgaaaatgaggggcggcttgctgagaacctacatcatcagcatcctc
ttcaagtctgtcttcgaggtggccttcctgctcatccagtggtacatctatgggttcagc
ttgagcgcggtctacacctgcaagagagatccctgcccccaccaggtagactgcttcctc
tcacgtcccacggagaaaaccatcttcatcatcttcatgctggtggtgtccttggtgtct
ctcgctttgaacatcattgagctcttctacgtcttcttcaaaggcgttaaggatcgcgtg
aagggaagaagcgatccttaccacgccaccactggcccactgagcccatcaaaagactgc
ggatctccaaaatacgcctacttcaatggctgctcctcaccaacggctccactctcgcct
atgtctcctcctgggtacaagctggttactggtgacagaaacaattcctcgtgccgcaat
tacaacaagcaagctagcgagcaaaactgggcgaactacagcgcagagcaaaatcgcatg
gggcaggccggaagcaccatctccaactcgcacgcccagccgttcgatttccccgacgac
aaccagaatgccaaaaaagttgctgctggacatgaactccagccattagccatcgtggac
caacgaccttccagcagagccagcagccgcgccagcagcaggcctcggcctgatgacctg
gagatttaa

DBGET integrated database retrieval system