KEGG   Rattus norvegicus (rat): 24399
Entry
24399             CDS       T01003                                 

Gene name
Glud1
Definition
(RefSeq) glutamate dehydrogenase 1, mitochondrial precursor
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00250  Alanine, aspartate and glutamate metabolism
rno00471  D-Glutamine and D-glutamate metabolism
rno00910  Nitrogen metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04217  Necroptosis
rno04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    24399 (Glud1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    24399 (Glud1)
   00220 Arginine biosynthesis
    24399 (Glud1)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    24399 (Glud1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24399 (Glud1)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    24399 (Glud1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24399 (Glud1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     24399 (Glud1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   24399 (Glud1)
SSDB
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 24399
NCBI-ProteinID: NP_036702
RGD: 2708
Ensembl: ENSRNOG00000057367
Vega: OTTRNOG00000001799
UniProt: P10860
Position
16
AA seq 558 aa
MYRRLGEVLLLSRAGPAALGSAAADSAALLGWARGQPSAVPQPGLTPVARRHYSEAATDR
EDDPNFFKMVEGFFDRGASIVEDKLVEDLKTRENEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGLG
DKTFVVQGFGNVGLHSMRYLHRFGAKCVGVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKVYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPVVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGVTFT
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgtaccgccgtctgggcgaagtgctgctactgtcccgcgccgggcccgctgccctgggc
tctgcggctgcagactcagccgcactgctgggctgggctcgcggacaaccctctgctgtc
ccgcaacccgggctcacgccggtcgccaggcgccactacagcgaagcggccaccgaccgc
gaagacgaccccaacttcttcaagatggtggagggcttcttcgaccgcggcgccagcatc
gtggaggacaagctggtggaagacctgaagacccgggagaacgaggagcagaagcggaac
cgagtgcgcggcatcctgcggatcatcaagccttgcaaccatgtgttgagcctctccttc
cccatccggcgcgacgacggctcctgggaggtcatcgaaggctaccgggcccagcacagc
cagcaccgcacgccctgcaagggaggtatccggtacagcactgacgtgagtgtggatgag
gtgaaggcgctggcgtccctaatgacctacaagtgtgcagtggttgatgtgccatttgga
ggtgctaaagcaggcgttaagatcaatcccaagaactatacagataatgaattagaaaag
attacacgaagattcaccatggagctggcaaagaagggttttattggtcctggcattgat
gtgcctgccccagacatgagcacgggcgagcgggagatgtcctggatcgctgacacctat
gccagcaccatagggcactatgatatcaatgcacacgcctgcgtcactggtaaacccatc
agccaaggaggcatccacggacgcatctccgctactggccggggtgtttttcatgggatt
gagaacttcatcaatgaagcttcctacatgagcatcttagggatgaccccggggcttggc
gataagacgtttgttgttcagggatttggtaatgtgggcctgcactctatgagatattta
catcgttttggtgctaagtgtgttggtgttggagaatctgatgggagtatatggaatcca
gatggtattgacccaaaagaactggaagatttcaagttgcaacatggatcaattctgggc
ttccccaaagccaaggtctatgaaggaagcatcttggaggctgactgcgacattttaatc
cctgcagccagcgagaagcagttgaccaaatccaatgcacccagagtcaaagccaagatc
attgctgaaggagccaatggcccaaccactccagaggccgataagattttcctagaaaga
aacatcatggttattccagatctctacctgaatgctggaggagtgacagtatcttacttt
gagtggctaaagaatctaaatcacgtcagctatggccgattgaccttcaaatatgaaagg
gactcgaactaccacttgctcatgtccgttcaagagagtttagagagaaagtttggaaag
cacggcgggactatccctgtggtccccacagcagagttccaggacagaatatcgggtgca
tctgagaaagacatcgtgcactctggcttggcctacacaatggagcgatctgccaggcaa
attatgcgcacagccatgaagtataacctgggattggacctgagaacagctgcctacgtc
aatgccattgagaaagtcttcaaggtgtataatgaggctggcgtgaccttcacatag

DBGET integrated database retrieval system