KEGG   Rattus norvegicus (rat): 24412Help
Entry
24412             CDS       T01003                                 

Gene name
Grin2d, GluN2D
Definition
(RefSeq) glutamate ionotropic receptor NMDA type subunit 2D
  KO
K05212  glutamate receptor ionotropic, NMDA 2D
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05033  Nicotine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24412 (Grin2d)
   04024 cAMP signaling pathway
    24412 (Grin2d)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24412 (Grin2d)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24412 (Grin2d)
   04720 Long-term potentiation
    24412 (Grin2d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24412 (Grin2d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24412 (Grin2d)
   05014 Amyotrophic lateral sclerosis (ALS)
    24412 (Grin2d)
  09165 Substance dependence
   05030 Cocaine addiction
    24412 (Grin2d)
   05031 Amphetamine addiction
    24412 (Grin2d)
   05033 Nicotine addiction
    24412 (Grin2d)
   05034 Alcoholism
    24412 (Grin2d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24412 (Grin2d)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   24412 (Grin2d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C MatE
Motif
Other DBs
NCBI-GeneID: 24412
NCBI-ProteinID: NP_073634
RGD: 2740
Ensembl: ENSRNOG00000021063
UniProt: Q62645
Structure
PDB: 

Position
1q22
AA seq 1323 aa AA seqDB search
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGAVGGGTGGARPLNVALVFSGPAYA
AEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPPSLVLQLCDLLSGLRVHGVVFEDDSRA
PAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYD
WTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLGAQLRSVSAQI
RLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGVPGEPLLLPGGSPLPAG
LFAVASAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRTQNRTHRGESLHRY
FMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFL
QPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRC
CKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTIN
EERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFI
FEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWA
FFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIR
SNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKV
FATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDID
NMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAP
PPAKPPPPPQPLPSPAYPAARPPPGPAPFVPRERAAADRWRRAKGTGPPGGAAIADGFHR
YYGPIEPQGLGLGEARAAPRGAAGRPLSPPTTQPPQKPPPSYFAIVREQEPTEPPAGAFP
GFPSPPAPPAAAAAAVGPPLCRLAFEDESPPAPSRWPRSDPESQPLLGGGAGGPSAGAPT
APPPRRAAPPPCAYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYAERLGPPPGR
YWSVDKLGGWRAGSWDYLPPRGGPAWHCRHCASLELLPPPRHLSCSHDGLDGGWWAPPPP
PWAAGPPPRRRARCGCPRPHPHRPRASHRAPAAAPHHHRHRRAAGGWDFPPPAPTSRSLE
DLSSCPRAAPTRRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFSSLE
SEV
NT seq 3972 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgccggtggcccccgcggccctcggggccccgctaagatgctgctgctgctg
gcgctggcgtgcgccagcccgttcccggaggaggtgccggggccgggcgcggtcggcggg
ggcacgggcggggcgcggccactcaacgtggcgcttgtcttctccggcccggcatatgcg
gcagaggcggcgcgcttgggcccggccgtggcagcggcagtgcgcagccccggcctggac
gtacggcccgtggcgctggtgctcaacggctccgaccctccgagccttgtgctgcagctc
tgcgacctgctgtcggggctgcgcgtgcacggcgtggtgttcgaggacgactcgcgcgcg
cccgccgtcgcgcccattctcgacttcctgtccgcgcagacctcgctgcccatcgtagcc
gtgcacggcggcgccgcgctcgtgctcacacccaaggagaagggctccaccttcctgcag
cttggctcctccacagagcaacagttgcaggtcatttttgaggtgctggaggagtacgac
tggacatcctttgtggcagtgaccacgcgtgccccaggccatcgggccttcttgtcatac
atcgaggtgctgactgatggcagcctggtgggctgggagcatcgaggagcgctgacactg
gaccccggggcgggtgaggctgtactgggcgcacagctccgtagtgtcagtgcgcagatc
cgcctgctcttctgcgcccgcgaggaggcagagcctgttttccgggcagcggaagaggcc
ggcctcactgggcctggctacgtctggttcatggtgggaccccagctggctggaggcggg
ggctccggggtccctggggagccccttcttctgccaggaggttccccactgcctgccggg
ctgtttgcagtggcctctgctggctggcgtgacgacttggcacgtcgagtggctgctggt
gtggcggtggtggccagaggtgcccaggccctgctgcgagactatggcttcctgcctgag
ctgggtcatgactgccgcacccagaatcgcacccaccgcggggagagtctgcacaggtac
ttcatgaacatcacctgggataaccgagactactccttcaatgaggatggctttctggtg
aacccttcactggtggtcatctccctcaccagagacaggacatgggaagtggtgggcagc
tgggaacagcagaccctccgcctcaagtaccctctatggtcccgctatggccgcttcctg
cagccagtggatgacacacagcacctcactgtggccacgctggaggagagaccctttgtc
attgtagagcctgcagaccccatcagcggcacttgcatcagagactcggtcccctgccgg
agccagctcaaccgtacccacagccctccgcctgacgctccccgcccggagaagagatgc
tgcaagggtttctgcattgatattctgaagaggctggcgcacaccatcggtttcagctat
gacctctacctggttaccaacggcaagcatggcaagaagatcgatggcgtctggaatggc
atgattggtgaggtgttctatcagcgtgcggacatggccatcggctctctcaccatcaat
gaggagcggtcagagatcgtggacttctccgtcccctttgtagagacaggcatcagcgtc
atggtggcacgcagcaatggcactgtgtccccctctgccttcctcgagccctacagccct
gctgtctgggtgatgatgttcgtcatgtgcctcaccgtggtcgccgtcacagttttcatc
tttgagtacctcagtcctgtgggctataaccgaagcctggccacgggcaaacgccctggt
ggctctaccttcaccattgggaaatccatctggctgctgtgggccctggtcttcaacaac
tccgtgccagtggagaatcctcggggcaccaccagcaagatcatggtgctggtgtgggcc
ttcttcgcggtcatctttcttgccagctacacagccaatctggccgccttcatgatccag
gaggagtacgtggacaccgtgtctgggctcagcgaccggaagttccagcgaccccaggag
caatacccacctctgaagtttggcacggtgcccaatgggtccacggaaaagaacatccgg
agcaactaccctgacatgcacagctacatggtgcgatacaaccagccgagagtggaggag
gcactcacacagctcaaggcagggaaactggacgccttcatctatgacgcagcagtgctc
aactacatggcccgcaaggatgagggctgcaagctggtcaccatcggctccggcaaggtc
ttcgccaccactggttatggcatcgccctacacaagggctcccgctggaagaggcccatc
gacctggcgctgctgcagttcctgggggacgatgagattgagatgctggagcggctgtgg
ctttcagggatctgccacaatgacaaaatcgaagtgatgagtagcaagctggatatcgac
aacatggcaggtgtcttctacatgctccttgtggccatgggcctctccttgctggtcttc
gcctgggaacatctggtgtactggcgcctgcggcattgcctgggtcccacccaccgcatg
gatttcctactggccttctccaggggtatgtacagctgctgcagcgccgaggctgctcca
ccgccggccaagcctccgccaccgcctcagccgctgcccagtcccgcatatcccgccgct
cgcccgccccctggccccgcacccttcgtgccccgagagcgcgcagctgccgaccgctgg
cgccgagccaagggcacagggcccccggggggcgcagcgatagccgacggcttccaccga
tactacggccccatcgagccacaggggctgggcctcggcgaggcacgcgcggcaccgaga
ggcgcagccggacgcccactgtccccacccaccacacagcccccgcagaagccaccacct
tcctacttcgccatcgtgcgcgagcaggagccgaccgagcccccggccggcgccttcccc
ggcttcccatctccgcctgcgccgcccgctgcggctgccgctgccgtcgggccgccactg
tgtcgcctggctttcgaggacgaaagcccgcccgcaccctcgcgctggccgcgttcagat
cccgagagccagcctctgttgggtgggggcgcgggcggcccgagcgcgggggccccaacc
gcaccaccgccgcgccgtgccgcgccaccaccgtgcgcctacctggacctcgagccttcg
ccttcggactccgaggactcggagagcctgggcggagcatcgctcggtggcctggagccc
tggtggttcgccgacttcccctacccgtatgccgagcgcctcgggccgccgcccggccgc
tactggtcggtcgacaagctcgggggctggcgcgctggtagctgggactacctgcccccg
cgcggaggccccgcgtggcactgccgccactgcgccagcctggagctgctaccgccaccg
cgccacctcagctgctcgcacgacggcttagacggcggctggtgggcgcctccgcctcca
ccctgggccgcggggccacctccccggcgccgggcgcgctgtggttgtccgcgacctcac
ccacaccgcccccgggcctcgcaccgtgcgcccgccgccgcgccgcaccaccaccgacac
aggcgcgcggccggtggctgggacttcccgccgcccgcgcccacctcgcgttcgctggag
gacctgagctcctgcccgcgggcggcccccacgcgcaggctcaccgggccatcccgccac
gcgcgccgctgcccgcacgctgcgcactgggggccgcccctgcccaccgcatcgcaccgg
agacaccggggcggggacctgggcacacgcaggggctctgcgcatttctccagcctggag
tccgaggtatga

DBGET integrated database retrieval system