KEGG   Rattus norvegicus (rat): 24417Help
Entry
24417             CDS       T01003                                 

Gene name
Grm4
Definition
(RefSeq) glutamate metabotropic receptor 4
  KO
K04607  metabotropic glutamate receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04724  Glutamatergic synapse
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    24417 (Grm4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24417 (Grm4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24417 (Grm4)
  09157 Sensory system
   04742 Taste transduction
    24417 (Grm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24417 (Grm4)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   24417 (Grm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 Haem_degrading
Motif
Other DBs
NCBI-GeneID: 24417
NCBI-ProteinID: NP_073157
RGD: 2745
UniProt: P31423
Position
20p12
AA seq 912 aa AA seqDB search
MSGKGGWAWWWARLPLCLLLSLYAPWVPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVRALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAFIQ
KSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARGIIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNGSAEYKVIGSWTDHLHLRIERMQWPGSGQQLPRSICSLPCQPGERKKTVKGMACCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTSCQPIPIVKLEWDSPWAVLPLFLAVVGIA
ATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFILISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLETPALAT
KQTYVTYTNHAI
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagggaggctgggcctggtggtgggcccggctgcccctctgcctactcctc
agcctttatgccccctgggtgccttcatccttgggaaagcccaagggtcacccccacatg
aactctatccgaattgacggggacatcacactgggaggcctgtttcccgtccacggccgt
ggctctgagggtaaggcctgcggggagctgaagaaggagaaaggcatccaccgcctggag
gccatgctgtttgccctggaccgcatcaacaatgacccggacctactgcccaacatcacg
ttgggcgcccgcattctggacacctgctcgagggacacccacgccctggagcagtcactg
acctttgtgcgggcgctcatcgagaaggacggcacggaggtccgctgcggcagcgggggc
ccgcccatcatcaccaagcccgaacgagtggtgggtgtcattggagcttcggggagctcc
gtctcgatcatggtggccaacatcctccgcctcttcaagatccctcagatcagctatgcc
tccacggcccctgacttgagtgacaacagccgctatgacttcttctcccgggtggtgccc
tcagacacataccaggcccaggccatggtggatattgtccgagccctcaagtggaactat
gtgtccacactggcctcagagggcagctacggtgagagtggtgtggaggcctttatccag
aagtcccgagagaacggaggtgtgtgcattgcccagtcggtgaagattccacgggaaccc
aagacgggggagttcgacaagatcatcaaacgcctactggaaacatccaatgccaggggt
atcatcatctttgccaacgaggatgacatcaggagggtgttggaggcagctcgcagggcc
aaccagaccggccacttcttttggatgggttctgatagctggggctccaagagtgcccct
gtgctgcgccttgaggaggtggccgagggcgcagtcaccattctccccaagaggatgtct
gttcgagggttcgaccgatacttctccagccgcacgctggacaacaacaggcgcaacatc
tggtttgccgagttctgggaggacaacttccattgcaagttgagccgccacgcgctcaag
aagggaagccacatcaagaagtgcaccaaccgagagcgcatcgggcaggactcggcctat
gagcaggaggggaaggtgcagttcgtgattgacgctgtgtacgccatgggccacgcgctg
cacgccatgcaccgtgacctgtgtcccggccgcgtaggactctgccctcgcatggacccc
gtggatggcacccagctgcttaagtacatcaggaacgtcaacttctcaggcattgcgggg
aaccctgtaaccttcaatgagaacggagacgcaccggggcgctacgacatctaccagtac
caactgcgcaatggctcggccgagtacaaggtcatcggctcgtggacagaccacctgcac
ctcagaatagagcggatgcagtggccagggagtggccagcagctgccgcgctccatctgc
agtctgccctgccagcccggggagcgaaagaagactgtgaagggcatggcttgctgctgg
cactgcgagccctgcaccgggtaccagtaccaagtggaccgctacacctgtaagacctgc
ccctacgacatgcggcccacagagaaccgcacgagctgccagcccatccccatcgtcaag
ttggagtgggactcgccgtgggccgtgctgcccctcttcctggccgtggtgggcatcgcc
gccacgctgttcgtggtggtcacgtttgtgcgctacaacgatacccccatcgtcaaggcc
tcgggccgggagctgagctacgtgctgctggcgggcatctttctgtgctacgccactacc
ttcctcatgatcgcagagccggacctggggacctgttcgctccgccgcatcttcctaggg
ctcggcatgagcatcagctacgcggccctgctgaccaagaccaaccgcatttaccgcatc
tttgagcagggcaaacggtcggtcagtgccccgcgtttcatcagcccggcctcgcagctg
gccatcaccttcatcctcatctccctgcagctgctcggcatctgcgtgtggttcgtggtg
gacccctcccactcggtggtggacttccaggaccaacggacacttgacccccgctttgcc
aggggcgtgctcaagtgcgacatctcggacctgtccctcatctgcctgctgggctacagc
atgctgctgatggtcacgtgtactgtgtacgccatcaagacccgaggcgtgcccgagacc
ttcaacgaggccaagcccatcggcttcaccatgtacaccacctgcattgtctggctggcc
ttcatccccatcttttttggcacctcacagtcagccgacaagctgtacatccagacaacc
acactgacggtctccgtgagtctgagcgcttcagtgtccctggggatgctctacatgccc
aaagtctacatcatcctcttccacccggagcagaacgtgcccaagcgcaagcgcagtctc
aaagccgtggtcaccgccgccaccatgtccaacaagttcacacagaagggcaacttcagg
cccaatggggaagccaaatcagagctgtgtgagaacctggagaccccagcgctggctacc
aaacagacctacgtcacctacaccaaccatgccatctag

DBGET integrated database retrieval system