KEGG   Rattus norvegicus (rat): 24418Help
Entry
24418             CDS       T01003                                 

Gene name
Grm5, mGluR5
Definition
(RefSeq) glutamate metabotropic receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04540  Gap junction
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno05010  Alzheimer disease
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24418 (Grm5)
   04072 Phospholipase D signaling pathway
    24418 (Grm5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24418 (Grm5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24418 (Grm5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24418 (Grm5)
   04720 Long-term potentiation
    24418 (Grm5)
   04723 Retrograde endocannabinoid signaling
    24418 (Grm5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24418 (Grm5)
   05016 Huntington disease
    24418 (Grm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24418 (Grm5)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   24418 (Grm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Motif
Other DBs
NCBI-GeneID: 24418
NCBI-ProteinID: NP_058708
RGD: 2746
Ensembl: ENSRNOG00000016429
UniProt: P31424
Position
1q32
AA seq 1171 aa AA seqDB search
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSD
KTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGIC
IAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLL
LGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQH
RFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPG
YAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDY
INVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENE
YVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIF
IIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSA
LVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMH
DYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTT
CIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTST
VVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLSSNGKSVTWAQNEKSTRGQHLWQRL
SVHINKKENPNQTAVIKPFPKSTENRGPGAAAGGGSGPGVAGAGNAGCTATGGPEPPDAG
PKALYDVAEAEESFPAAARPRSPSPISTLSHLAGSAGRTDDDAPSLHSETAARSSSSQGS
LMEQISSVVTRFTANISELNSMMLSTAATPGPPGTPICSSYLIPKEIQLPTTMTTFAEIQ
PLPAIEVTGGAQGATGVSPAQETPTGAESAPGKPDLEELVALTPPSPFRDSVDSGSTTPN
SPVSESALCIPSSPKYDTLIIRDYTQSSSSL
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcctacttctgaaagaagatgtacgagggagtgca
cagtccagtgagaggagggtggtggctcacatgccaggtgacatcattattggagctctc
ttctctgtccaccaccaaccaactgtggacaaagttcatgagaggaagtgtggtgcagtt
cgtgagcaatatgggattcagagagtggaggccatgctgcataccttggaaaggatcaac
tcagatcccacactcttgcccaacatcacacttggctgtgagatcagagattcctgctgg
cattccgctgtggccctagaacaaagcattgagtttataagggattccctcatctcttca
gaagaggaggaaggtttggtacgctgtgtagatggatcttcttccttccgctccaagaaa
cccatagtgggagtcattgggcctggctcgagttctgtggccattcaagtccagaactta
ctccagcttttcaacataccacagattgcttactctgcaaccagcatggatttgagtgac
aagactctattcaagtacttcatgagggttgtaccttccgatgcccagcaagctcgagcc
atggtagacatagtgaagagatacaactggacttatgtctcagctgtgcacacagaaggc
aactatggagaaagtgggatggaggctttcaaagatatgtcagcgaaggaagggatttgc
atcgcccactcttacaaaatttacagcaatgctggggaacagagctttgacaagctgttg
aaaaaactcagaagtcatttacctaaagcccgggtggtagcttgcttctgtgaaggcatg
acagttcgaggtctgctcatggccatgagacgcttaggtctagcaggggagtttctactt
ctgggcagtgatggctgggccgacaggtatgacgtgacagatggatatcagcgagaagct
gtcggtggaattacaatcaagcttcagtctcctgatgtcaagtggtttgatgattattat
ctgaaactccggccagaaacaaacctcagaaacccttggtttcaagaattttggcagcat
cgttttcagtgccggctggaagggtttgcacaggagaacagcaagtacaacaagacttgc
aacagttctctgactctgagaacacatcatgttcaagattccaaaatgggatttgtgata
aatgcaatctattctatggcttatggactccacaatatgcagatgtccctgtgtccaggc
tatgcaggcctctgtgatgcgatgaagccaattgatggacggaaacttttggattccctg
atgaaaaccaattttactggagtttctggagatatgatcctgtttgatgaaaatggagac
tctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgattac
atcaatgttggaagttgggacaatggggaattaaaaatggatgatgacgaagtgtggtcc
aagaaaaataacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccaaataaag
gtgatccggaagggagaagtcagctgttgttggacctgcacaccttgtaaagagaatgag
tatgtgtttgatgagtacacctgcaaggcatgccaactgggctcctggcccactgacgac
ctgacaggctgtgacttgatcccagtccagtatcttcgctggggtgaccctgagccgatt
gcagctgtggtgtttgcctgcctcggtctgctagccaccttattcgttactgtaatcttc
atcatttatcgggacactccggtggtcaagtcctccagcagggagctctgctacattatc
cttgctggcatctgcctgggatacttatgtaccttttgcctcattgcaaagcccaagcag
atttactgctatcttcagagaattggcattggactctctccagccatgagctactcagcc
cttgtaaccaagaccaaccgtattgcaaggattctagctggaagcaagaagaaaatctgt
accaagaagcccagattcatgagcgcctgtgctcagttagtgatcgctttcattctcatc
tgtattcagctgggcattatcgtggccctctttatcatggagcctccggatataatgcat
gactatccaagcatccgagaagtctacttgatttgtaacaccaccaacctaggggttgtt
actcctcttggatacaatggattattgattttgagttgcacgttctatgcgtttaagacc
agaaatgttccagccaactttaatgaggccaaatatattgctttcaccatgtacacaacc
tgcatcatatggctggccttcgtgcctatctactttggcagcaactacaaaatcatcacc
atgtgtttttcagtcagcctcagtgccacagtggccctgggttgcatgtttgtcccgaag
gtgtacatcatcctagccaaaccggagagaaatgtgcgcagcgccttcacaacctctaca
gtggtacgcatgcatgtaggagacggcaaatcatcgtccgctgccagcagatccagcagc
ctagtcaacctgtggaagaggaggggctcctctggggaaaccctaagctccaacggaaaa
tctgtgacttgggcccagaatgagaagagtacccgggggcaacatttgtggcagcgactg
tctgtccacatcaacaagaaggagaaccccaaccaaacggcggtcatcaaaccctttccc
aagagcacagagaaccgggggcctggtgcagcggcaggtggtggctcgggtcccggtgta
gctggtgctggtaacgcaggatgcacagcaacaggtggcccggagccaccggacgccggt
cccaaagcgctttatgatgtggcggaggcagaggagagcttccccgcggctgccaggccg
cgctcgccatcgcccatcagcacgttgagccacctcgcaggctcggcgggccgcacagat
gatgatgcgccgtcgctgcactctgagacagctgctcgcagcagctcgtcccagggctcg
ctcatggagcagatcagcagcgtagtgacgcgcttcacagccaacatctccgagctcaac
tccatgatgttgtccaccgcggccacgccggggccccctggtactccaatctgctcctcc
tacctgatccccaaagagattcagctgcccacgaccatgacgaccttcgcagagatccag
ccgctgccggccatcgaggtgaccggaggagctcagggggcgacaggcgtatcacctgcc
caggagacgcccacaggagctgaatccgccccgggcaaaccagatctggaggagcttgtg
gccctcactccaccatcgcccttcagggactcggtggactcggggagcaccaccccaaac
tctccagtctcagaatcggccctctgcatcccatcctctcccaaatatgacactctcatc
atcagagattacacgcagagttcttcatcgttgtga

DBGET integrated database retrieval system