KEGG   Rattus norvegicus (rat): 24418Help
Entry
24418             CDS       T01003                                 

Gene name
Grm5, mGluR5
Definition
(RefSeq) glutamate metabotropic receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04540  Gap junction
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24418 (Grm5)
   04072 Phospholipase D signaling pathway
    24418 (Grm5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24418 (Grm5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24418 (Grm5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24418 (Grm5)
   04720 Long-term potentiation
    24418 (Grm5)
   04723 Retrograde endocannabinoid signaling
    24418 (Grm5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    24418 (Grm5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24418 (Grm5)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   24418 (Grm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Motif
Other DBs
NCBI-GeneID: 24418
NCBI-ProteinID: NP_058708
RGD: 2746
Ensembl: ENSRNOG00000016429
UniProt: P31424
Position
1q32
AA seq 1171 aa AA seqDB search
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSD
KTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGIC
IAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLL
LGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQH
RFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPG
YAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDY
INVGSWDNGELKMDDDEVWSKKNNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENE
YVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVIF
IIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSA
LVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMH
DYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTT
CIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTST
VVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLSSNGKSVTWAQNEKSTRGQHLWQRL
SVHINKKENPNQTAVIKPFPKSTENRGPGAAAGGGSGPGVAGAGNAGCTATGGPEPPDAG
PKALYDVAEAEESFPAAARPRSPSPISTLSHLAGSAGRTDDDAPSLHSETAARSSSSQGS
LMEQISSVVTRFTANISELNSMMLSTAATPGPPGTPICSSYLIPKEIQLPTTMTTFAEIQ
PLPAIEVTGGAQGATGVSPAQETPTGAESAPGKPDLEELVALTPPSPFRDSVDSGSTTPN
SPVSESALCIPSSPKYDTLIIRDYTQSSSSL
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcctacttctgaaagaagatgtacgagggagtgca
cagtccagtgagaggagggtggtggctcacatgccaggtgacatcattattggagctctc
ttctctgtccaccaccaaccaactgtggacaaagttcatgagaggaagtgtggtgcagtt
cgtgagcaatatgggattcagagagtggaggccatgctgcataccttggaaaggatcaac
tcagatcccacactcttgcccaacatcacacttggctgtgagatcagagattcctgctgg
cattccgctgtggccctagaacaaagcattgagtttataagggattccctcatctcttca
gaagaggaggaaggtttggtacgctgtgtagatggatcttcttccttccgctccaagaaa
cccatagtgggagtcattgggcctggctcgagttctgtggccattcaagtccagaactta
ctccagcttttcaacataccacagattgcttactctgcaaccagcatggatttgagtgac
aagactctattcaagtacttcatgagggttgtaccttccgatgcccagcaagctcgagcc
atggtagacatagtgaagagatacaactggacttatgtctcagctgtgcacacagaaggc
aactatggagaaagtgggatggaggctttcaaagatatgtcagcgaaggaagggatttgc
atcgcccactcttacaaaatttacagcaatgctggggaacagagctttgacaagctgttg
aaaaaactcagaagtcatttacctaaagcccgggtggtagcttgcttctgtgaaggcatg
acagttcgaggtctgctcatggccatgagacgcttaggtctagcaggggagtttctactt
ctgggcagtgatggctgggccgacaggtatgacgtgacagatggatatcagcgagaagct
gtcggtggaattacaatcaagcttcagtctcctgatgtcaagtggtttgatgattattat
ctgaaactccggccagaaacaaacctcagaaacccttggtttcaagaattttggcagcat
cgttttcagtgccggctggaagggtttgcacaggagaacagcaagtacaacaagacttgc
aacagttctctgactctgagaacacatcatgttcaagattccaaaatgggatttgtgata
aatgcaatctattctatggcttatggactccacaatatgcagatgtccctgtgtccaggc
tatgcaggcctctgtgatgcgatgaagccaattgatggacggaaacttttggattccctg
atgaaaaccaattttactggagtttctggagatatgatcctgtttgatgaaaatggagac
tctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattattttgattac
atcaatgttggaagttgggacaatggggaattaaaaatggatgatgacgaagtgtggtcc
aagaaaaataacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccaaataaag
gtgatccggaagggagaagtcagctgttgttggacctgcacaccttgtaaagagaatgag
tatgtgtttgatgagtacacctgcaaggcatgccaactgggctcctggcccactgacgac
ctgacaggctgtgacttgatcccagtccagtatcttcgctggggtgaccctgagccgatt
gcagctgtggtgtttgcctgcctcggtctgctagccaccttattcgttactgtaatcttc
atcatttatcgggacactccggtggtcaagtcctccagcagggagctctgctacattatc
cttgctggcatctgcctgggatacttatgtaccttttgcctcattgcaaagcccaagcag
atttactgctatcttcagagaattggcattggactctctccagccatgagctactcagcc
cttgtaaccaagaccaaccgtattgcaaggattctagctggaagcaagaagaaaatctgt
accaagaagcccagattcatgagcgcctgtgctcagttagtgatcgctttcattctcatc
tgtattcagctgggcattatcgtggccctctttatcatggagcctccggatataatgcat
gactatccaagcatccgagaagtctacttgatttgtaacaccaccaacctaggggttgtt
actcctcttggatacaatggattattgattttgagttgcacgttctatgcgtttaagacc
agaaatgttccagccaactttaatgaggccaaatatattgctttcaccatgtacacaacc
tgcatcatatggctggccttcgtgcctatctactttggcagcaactacaaaatcatcacc
atgtgtttttcagtcagcctcagtgccacagtggccctgggttgcatgtttgtcccgaag
gtgtacatcatcctagccaaaccggagagaaatgtgcgcagcgccttcacaacctctaca
gtggtacgcatgcatgtaggagacggcaaatcatcgtccgctgccagcagatccagcagc
ctagtcaacctgtggaagaggaggggctcctctggggaaaccctaagctccaacggaaaa
tctgtgacttgggcccagaatgagaagagtacccgggggcaacatttgtggcagcgactg
tctgtccacatcaacaagaaggagaaccccaaccaaacggcggtcatcaaaccctttccc
aagagcacagagaaccgggggcctggtgcagcggcaggtggtggctcgggtcccggtgta
gctggtgctggtaacgcaggatgcacagcaacaggtggcccggagccaccggacgccggt
cccaaagcgctttatgatgtggcggaggcagaggagagcttccccgcggctgccaggccg
cgctcgccatcgcccatcagcacgttgagccacctcgcaggctcggcgggccgcacagat
gatgatgcgccgtcgctgcactctgagacagctgctcgcagcagctcgtcccagggctcg
ctcatggagcagatcagcagcgtagtgacgcgcttcacagccaacatctccgagctcaac
tccatgatgttgtccaccgcggccacgccggggccccctggtactccaatctgctcctcc
tacctgatccccaaagagattcagctgcccacgaccatgacgaccttcgcagagatccag
ccgctgccggccatcgaggtgaccggaggagctcagggggcgacaggcgtatcacctgcc
caggagacgcccacaggagctgaatccgccccgggcaaaccagatctggaggagcttgtg
gccctcactccaccatcgcccttcagggactcggtggactcggggagcaccaccccaaac
tctccagtctcagaatcggccctctgcatcccatcctctcccaaatatgacactctcatc
atcagagattacacgcagagttcttcatcgttgtga

DBGET integrated database retrieval system