KEGG   Rattus norvegicus (rat): 24419
Entry
24419             CDS       T01003                                 

Gene name
Grm6, mGluR6
Definition
(RefSeq) glutamate metabotropic receptor 6
  KO
K04608  metabotropic glutamate receptor 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    24419 (Grm6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24419 (Grm6)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    24419 (Grm6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24419 (Grm6)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24419 (Grm6)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24419 (Grm6)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   24419 (Grm6)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 24419
NCBI-ProteinID: NP_075209
RGD: 2747
Ensembl: ENSRNOG00000000233
UniProt: P35349
Position
10q22
AA seq 871 aa
MGRLPVLLLWLAWWLSQAGIACGAGSVRLAGGLTLGGLFPVHARGAAGRACGALKKEQGV
HRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGRGDGDEA
SVRCPGGVPPLRSAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTR
YDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIA
QSIKIPREPKPGEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGS
DSWGSKISPILNLEEEAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEENFN
CKLTSSGGQSDDSTRKCTGEERIGQDSAYEQEGKVQFVIDAVYAIAHALHSMHQALCPGH
TGLCPAMEPTDGRTLLHYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNGSASSGG
YQAVGQWAEALRLDMEVLRWSGDPHEVPPSQCSLPCGPGERKKMVKGVPCCWHCEACDGY
RFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLTWSSPWAALPLLLAVLGIMATTTIMAT
FMRHNDTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPCAAICAARRLLLGLGTTLSYS
ALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFGLTSLQVVGVIAWLGAQPPHSVID
YEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFNEAKPIG
FTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKTYVILFH
PEQNVQKRKRSLKKTSTMAAPPQNENAEDAK
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggggaggctcccggtgctgctgctatggctagcctggtggttgtcgcaggcaggcata
gcctgcggtgccggctccgtgcgcctggccggtggcctgacgctgggcggactattccca
gtgcacgcgcggggagccgcaggacgcgcgtgcggggcgctgaagaaagagcaaggcgtg
caccggctggaagcgatgctctacgcgctggaccgcgtcaacgctgacccggagctgctg
cccggcgtgcggctgggcgcgcggctgctcgacacctgctcgcgggacacctacgctttg
gagcaggctctgagcttcgtgcaggcgctcatccgaggccgcggagacggcgacgaggcc
agtgtgcgctgccctgggggagttcccccgctgcgctccgcgcctccagagcgcgtggtg
gcggtggtgggagcctcggctagctccgtgtccatcatggtggccaacgtcttgcgcctg
tttgcgataccccagatcagctatgcctccacagccccagagctcagtgactccacacgc
tatgacttcttctcccgagtggtgcctcctgactcctaccaggcccaggccatggtggac
attgtgcgggcactgggatggaattacgtgtctacattggcctctgagggcaactatggc
gagagcggggttgaggcctttgtgcagatttcccgtgaggctggaggtgtctgtattgcc
cagtcaataaagattcccagggagccaaagccgggagagttccacaaagtgatccggagg
ctcatggagacacccaacgcccgtggcatcatcatctttgccaatgaggatgacatcagg
agggtcttggaggcaacacgccaggccaacctgactggccacttcctgtgggttggctca
gacagctggggatccaagatctctcccatcttgaacctagaggaagaggctgtgggggcc
atcactatcttgcccaaaagggcttcaatcgacggatttgaccaatacttcatgactcgt
tccttggagaacaaccgcagaaacatctggtttgccgagttctgggaagagaattttaac
tgcaaactaaccagctccggtggccagtcagatgattccacccggaaatgcacaggtgag
gaacgcatcggccaggactccgcctatgagcaggaggggaaggtgcagttcgtgatagac
gctgtgtacgccattgctcacgctctgcatagcatgcaccaagcgctctgcccaggccac
acaggtctgtgcccagccatggagcctactgatggccggacgctgctgcactacatccga
gcagtccgcttcaatggtagtgcaggaaccccagtgatgttcaatgagaatggagatgcc
cccgggcgctatgacatcttccagtaccaggcaaccaacggaagcgccagcagcggcggg
taccaggccgtgggccaatgggcagaggcccttagactggatatggaagttctacggtgg
tcaggcgacccccacgaagtgcccccttctcagtgcagcctcccctgcgggcccggtgaa
cggaaaaagatggtgaagggtgtcccctgctgttggcactgtgaggcctgcgacgggtac
cgcttccaggtggacgagttcacatgcgaggcctgcccaggggacatgaggcccaccccc
aaccacactggttgccgtcccacacccgtggtgcgcctgacctggtcctctccatgggca
gctctgccccttctcctggctgtcctgggcatcatggctaccaccaccattatggccacc
ttcatgcgacacaatgacactcccatagtccgcgcctctggccgtgagcttagctacgtg
ctgctcactggcatcttcctgatctacgccatcaccttcctcatggtagccgagccttgt
gcagccatctgtgctgcccgcagactcttgcttggcttgggcaccacgctcagctactca
gccctgctcaccaagaccaaccgcatctaccgcatctttgagcaagggaagcgctctgtc
acaccaccacccttcatcagccccacttcgcaactagtcatcaccttcggcctcacctcc
ctgcaggtggtgggagtgatagcatggctgggggcccagcctccacacagcgtgattgac
tacgaggagcagaggacggtggaccccgagcaggccaggggtgtgctcaagtgtgatatg
tctgatctgtccctcattggttgcctgggctacagtctcctgctcatggtcacgtgtaca
gtgtatgccatcaaggcccgaggtgtgcctgagaccttcaatgaggccaagcccatcggc
ttcaccatgtacaccacctgtattatctggctggcttttgttcccatcttctttggtacc
gcccagtcagctgagaagatctacatccaaaccaccacactaactgtgtcactgagcctg
agtgcatcagtgtccctcggcatgctctacgtgcccaaaacctacgtcatcctgttccat
ccagagcagaacgtacagaagcggaagcgcagcctcaagaagacctccacgatggcagcc
ccaccccagaacgagaacgcagaggacgccaagtag

DBGET integrated database retrieval system