KEGG   Rattus norvegicus (rat): 24421Help
Entry
24421             CDS       T01003                                 

Gene name
Gsta1, GST_2-2, GST_A3-3, GST_AA, GST_Yc1, Gsta3, Gsta5, Yc1
Definition
(RefSeq) glutathione S-transferase alpha 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24421 (Gsta1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24421 (Gsta1)
   00982 Drug metabolism - cytochrome P450
    24421 (Gsta1)
   00983 Drug metabolism - other enzymes
    24421 (Gsta1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24421 (Gsta1)
   05204 Chemical carcinogenesis
    24421 (Gsta1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24421 (Gsta1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24421 (Gsta1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24421 (Gsta1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24421 (Gsta1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24421 (Gsta1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24421 (Gsta1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3
Motif
Other DBs
NCBI-GeneID: 24421
NCBI-ProteinID: NP_113697
RGD: 2753
UniProt: P04904 B6DYP8
Position
9q13
AA seq 221 aa AA seqDB search
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEAS
LAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPL
LKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccgg
tggctcctggctgcagctggagtagagtttgaagaacaatttctgaaaactcgggatgac
ctggccaggctaaggaatgatgggagtttgatgttccagcaagtgcccatggtggagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac
ctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggagtggcg
gatctggatgaaatagttctccattacccttacattccccctggggagaaagaggcaagt
cttgccaaaatcaaggacaaagcaaggaaccgttactttcctgcctttgaaaaggtgttg
aagagccatggacaagattatctcgttggcaataggctgagcagggctgatgtttaccta
gttcaagttctctaccatgtggaagagctggaccccagcgctttggccaacttccctctg
ctgaaggccctgagaaccagagtcagcaacctccccacagtgaagaagtttcttcagcct
ggcagccagaggaagccattagaggatgagaaatgtgtagaatctgcagttaagatcttc
agttaa

DBGET integrated database retrieval system