KEGG   Rattus norvegicus (rat): 24426
Entry
24426             CDS       T01003                                 

Gene name
Gstp1, GST-P, Gst3, Gstp, Gstp2
Definition
(RefSeq) glutathione S-transferase pi 1
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05215  Prostate cancer
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24426 (Gstp1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24426 (Gstp1)
   00982 Drug metabolism - cytochrome P450
    24426 (Gstp1)
   00983 Drug metabolism - other enzymes
    24426 (Gstp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24426 (Gstp1)
   05204 Chemical carcinogenesis
    24426 (Gstp1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24426 (Gstp1)
   05215 Prostate cancer
    24426 (Gstp1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24426 (Gstp1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24426 (Gstp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24426 (Gstp1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     24426 (Gstp1)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   24426 (Gstp1)
SSDB
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-GeneID: 24426
NCBI-ProteinID: NP_036709
RGD: 2758
Ensembl: ENSRNOG00000018237
UniProt: P04906 B6DYQ7
Position
1q43
AA seq 210 aa
MPPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGD
LTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYV
KALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAY
VARLSARPKIKAFLSSPDHLNRPINGNGKQ
NT seq 633 nt   +upstreamnt  +downstreamnt
atgccaccgtacaccattgtgtacttcccagttcgagggcgctgtgaggccacgcgcatg
ctgctggctgaccagggccagagctggaaggaggaggtggttaccatagatgtctggctt
caaggctcgctcaagtccacttgtctgtatgggcagctccccaagtttgaagatggagac
ctcaccctttaccaatctaatgccatcttgaggcacctgggtcgctctttagggctttat
gggaaagaccagaaggaggctgccttggtggatatggtgaatgatggggtggaggacctt
cgatgcaaatatggtaccctcatctacactaactatgagaatggtaaggatgactatgtg
aaggccctgcctgggcatctgaaaccttttgagaccctgctgtcccagaaccagggaggc
aaagctttcattgtgggtaaccagatttcctttgcagattacaacttgctggacctgctg
ctggtccaccaagtcctggcccctggctgcctggacaacttccccctgctctctgcctat
gtggctcgcctcagtgcccgccccaagatcaaggcctttctgtcctcccctgaccatttg
aaccgtcccatcaacggcaatggtaaacagtag

DBGET integrated database retrieval system