KEGG   Rattus norvegicus (rat): 24434
Entry
24434             CDS       T01003                                 

Gene name
Gusb, Ac2-223, Gus-s
Definition
(RefSeq) glucuronidase, beta
  KO
K01195  beta-glucuronidase [EC:3.2.1.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00531  Glycosaminoglycan degradation
rno00860  Porphyrin and chlorophyll metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno04142  Lysosome
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00076  Dermatan sulfate degradation
rno_M00077  Chondroitin sulfate degradation
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    24434 (Gusb)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    24434 (Gusb)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    24434 (Gusb)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    24434 (Gusb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    24434 (Gusb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     24434 (Gusb)
SSDB
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2
Other DBs
NCBI-GeneID: 24434
NCBI-ProteinID: NP_058711
RGD: 2772
Ensembl: ENSRNOG00000000913
UniProt: P06760
Position
12q12
AA seq 648 aa
MSPRRSVCWFVLGQLLCSCALALQGGMLFPKETPSRELKVLDGLWSFRADYSNNRLQGFE
KQWYRQPLRESGPTLDMPVPSSFNDITQEAELRNFIGWVWYEREAVLPQRWTQDTDRRVV
LRINSAHYYAVVWVNGIHVVEHEGGHLPFEADITKLVQSGPLTTFRVTIAINNTLTPYTL
PPGTIVYKTDPSMYPKGYFVQDISFDFFNYAGLHRSVVLYTTPTTYIDDITVTTDVDRDV
GLVNYWISVQGSDHFQLEVRLLDEDGKIVARGTGNEGQLKVPRAHLWWPYLMHEHPAYLY
SLEVTMTTPESVSDFYTLPVGIRTVAVTKSKFLINGKPFYFQGVNKHEDSDIRGRGFDWP
LLIKDFNLLRWLGANSFRTSHYPYSEEVLQLCDRYGIVVIDECPGVGIVLPQSFGNVSLR
HHLEVMDELVRRDKNHPAVVMWSVANEPVSSLKPAGYYFKTLIAHTKALDPTRPVTFVSN
TRYDADMGAPYVDVICVNSYLSWYHDYGHLEVIQLQLTSQFENWYKMYQKPIIQSEYGAD
AVSGLHEDPPRMFSEEYQTALLENYHLILDEKRKEYVIGELIWNFADFMTNQSPLRVTGN
KKGIFTRQRNPKMAAFILRERYWRIANETRGYGSVPRTQCMGSRPFTF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgtccccaagacggagtgtgtgttggttcgtactgggccagctgctgtgcagctgcgcg
ctggcgctgcagggcgggatgctgttcccgaaggagaccccttcgcgggaactcaaggtg
ctggacggcctgtggagcttccgtgccgattactcgaacaatcggttgcagggcttcgag
aagcagtggtaccggcagccgctacgggagtcgggcccaaccttggacatgccggtccct
tccagcttcaatgacatcacccaagaagcagagcttcggaacttcattggctgggtgtgg
tatgaacgggaagcagtgcttccacagcgatggacccaggacaccgacaggagagtggtg
ttgagaatcaacagcgcccattactatgcagttgtgtgggtgaatgggattcatgtggtg
gaacatgagggaggtcacctcccctttgaggctgacatcaccaagctggtccagagtggg
cccctgaccaccttccgggtcaccatcgccatcaacaacacactgaccccttataccctt
ccaccggggaccattgtctacaagactgatccttccatgtatcccaagggttacttcgtc
caggacataagcttcgacttcttcaactatgcggggctgcaccggtctgtggtcctgtac
accacccctaccacctatatcgatgatatcactgtgaccactgacgtggaccgggacgtt
gggctggtgaactactggatttctgtccagggcagtgaccatttccagctagaagtgcgt
cttctggatgaggatggcaaaattgtggcccgtggaacagggaatgagggtcaacttaag
gtgccgcgtgcccacctctggtggccttacctgatgcatgagcatccagcctacctgtac
tccttggaggtgacgatgacaacacctgagtctgtgtctgacttctataccctccctgtc
gggattcgaacagtggctgtcacaaagagcaagttcctcataaatgggaagcctttctac
ttccaaggcgtcaacaagcatgaggattcagatatccgagggagaggcttcgactggcct
ctgctgataaaggatttcaacctcctccgttggctcggggcaaattcctttcgtaccagc
cactatccctactcggaggaggtacttcagctctgtgaccgatatggaattgtggtcatc
gatgagtgtcccggtgtgggcatcgtgctgccccagagttttggcaacgtgtctcttcgg
caccacctagaggtgatggacgagctggtgcgcagggacaaaaatcaccctgcggtcgtg
atgtggtctgtggccaatgagcctgtctcttctctgaaacctgccggatattacttcaag
acgctgatcgcccacaccaaagccctggaccccacccgtcctgtgacctttgtgagcaat
accagatatgacgcagacatgggggccccgtacgtggacgtgatttgtgtgaacagttac
ttatcctggtatcatgactacgggcatctggaggtgattcagctgcagctgactagccag
tttgagaactggtataagatgtaccagaagccaattatccagagcgagtatggagcagac
gccgtctcggggcttcatgaggatccacctcgcatgttcagtgaggagtaccagacagct
ctcctggagaattatcatttgatcctggatgagaaacgaaaagaatatgtcatcggagag
ctcatctggaattttgctgacttcatgacgaaccagtcaccactgagagtaacaggaaac
aagaaggggatcttcactcgacagagaaaccccaagatggcagccttcattttgcgagag
agatactggaggattgccaacgaaaccagaggttacggttcagtgccgaggacccagtgt
atgggaagcagaccgttcacattctaa

DBGET integrated database retrieval system