KEGG   Rattus norvegicus (rat): 24438
Entry
24438             CDS       T01003                                 

Gene name
Hist1h1t, H1.3, H1D, H1f3, H1ft, H1s-4, H1t
Definition
(RefSeq) histone cluster 1 H1 family member t
  KO
K11275  histone H1/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    24438 (Hist1h1t)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    24438 (Hist1h1t)
SSDB
Motif
Pfam: Linker_histone PaaX
Other DBs
NCBI-GeneID: 24438
NCBI-ProteinID: NP_036711
RGD: 2778
Ensembl: ENSRNOG00000061863
UniProt: P06349
Position
17p11
AA seq 208 aa
MSETAPAASSTLVPAPVEKPATKRRGKKPGMATARKPRGFSVSKLIPEALSMSQERAGMS
LAALKKALAAAGYDVEKNNSRIKLALKRLVNKGVLVQTKGTGASGSFKLSKKAASGNDKG
KGKKSASAKAKKLGLSRASRSPKSSKTKVVKKPKATPTKGSGSRRKTKGAKGLQQRKSPA
KARATNSNSGKSKMVMQKTDLRKAAGRK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgtcggaaacggctcctgcagcctcaagtactcttgttccagctcctgtagagaaacct
gcaactaaaaggcgagggaagaagcctggcatggccactgctcgcaaacctcggggtttc
tcggtttccaagttgattcctgaggccctttccatgtctcaggaacgggcaggaatgtcc
cttgctgccctgaagaaagccctggctgcggctggctatgacgtggagaagaacaacagt
cgtatcaagctggccctcaagagacttgtgaataagggagtcctggtgcagaccaagggc
accggagcctcaggctccttcaagcttagcaagaaggcagcttcaggcaacgacaagggc
aagggcaagaaatctgcttctgccaaggctaagaaactgggcttgtccagggcctcgaga
tcccccaagagtagtaagaccaaggttgtcaagaagccaaaagctacgcccacaaagggt
tctgggagcagaaggaagaccaaaggggccaagggcttgcaacagcgcaaaagccccgcc
aaagcgagggcaaccaactccaactctgggaagtcaaagatggtcatgcagaagaccgac
ctaaggaaggcagcaggaagaaagtga

DBGET integrated database retrieval system