KEGG   Rattus norvegicus (rat): 24439Help
Entry
24439             CDS       T01003                                 

Gene name
Hagh, Glo2, RSP29
Definition
(RefSeq) hydroxyacyl glutathione hydrolase
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    24439 (Hagh)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     24439 (Hagh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 24439
NCBI-ProteinID: NP_203500
RGD: 2779
Ensembl: ENSRNOG00000014743
UniProt: O35952 F1LQI1
Position
10q12
AA seq 309 aa AA seqDB search
MVLGRGSLCLRSLSVLGAACARRGLGQALLGLSLCHTDFRKNLTVQQDMMKIELLPALTD
NYMYLIIDEDTQEAAVVDPVQPQKVIETVKKHRVKLTTVLTTHHHWDHAGGNEKLVKLEP
GLKVYGGDDRIGALTHKVTHLSTLQVGSLSVKCLSTPCHTSGHICYFVSKPGSSEPSAVF
TGDTLFVAGCGKFYEGTADEMYKALLEVLGRLPPDTKVYCGHEYTVNNLKFARHVEPGNT
AVQEKLAWAKEKNAIGEPTVPSTLAEEFTYNPFMRVKEKTVQQHAGETDPVTTMRAIRRE
KDQFKVPRD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggtcgcgggtcgctgtgcctccggagcctgtcagtgctgggagccgcctgc
gcgcgccgcggtctgggtcaggctctgctgggactctctctctgtcacacagacttcagg
aagaatctgaccgtgcagcaagacatgatgaagatcgaactactgcctgccctgactgac
aactacatgtacctgatcattgatgaggacacccaggaggccgccgttgtggacccagtg
cagccacagaaggttatagaaactgtgaaaaagcaccgtgtgaagctgaccacagtgctc
accactcaccaccactgggaccacgctggtgggaacgagaagttggtgaagctggaacct
gggctgaaggtttatggaggtgatgaccgcattggggccttgacccacaaggtcacacac
ctttccacactgcaggtggggtctctcagtgtcaaatgtctgtcaacaccctgccatact
tcagggcacatctgttactttgtgagcaagcctggtagctcagagccttctgctgtgttc
acaggtgacacattgtttgttgctggctgtgggaagttctatgagggaaccgcagacgag
atgtacaaggcgctgcttgaagtcttaggccggcttcctccagacacaaaagtctactgt
ggccatgaatacaccgtaaacaaccttaagtttgcgcgccatgtggagcccggcaatacc
gccgttcaagagaaactggcctgggccaaggagaagaatgccatcggggagcccacggtg
ccatccaccctggcagaggagttcacttacaaccccttcatgagagtgaaggagaagacc
gtgcagcagcacgctggagagaccgaccctgtgaccaccatgagggccatccgcagggag
aaagaccagtttaaggtgcctcgggactga

DBGET integrated database retrieval system