KEGG   Rattus norvegicus (rat): 24443Help
Entry
24443             CDS       T01003                                 

Gene name
Hdc
Definition
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00340  Histidine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    24443 (Hdc)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     24443 (Hdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 24443
NCBI-ProteinID: NP_058712
RGD: 2790
Ensembl: ENSRNOG00000010262
UniProt: A1A5M4
Position
3q36
AA seq 656 aa AA seqDB search
MMEPSEYREYQARGKEMVDYICQYLSTLRERQVTPNVKPGYLRAQIPSSAPEEPDSWDSI
FGDIEQIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEM
NIMDWLAKMLGLPDFFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKAHEPNAD
ESSLNARLVAYASDQAHSSVEKAGLISLVKIKFLPVDDNFSLRGEALQKAIEEDKQQGLV
PVFVCATLGTTGVCAFDKLSELGPICAREGLWLHVDAAYAGTAFLCPELRGFLKGIEYAD
SFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRF
RSIKLWFVIRSFGVKNLQAHVRHGTDMAKYFESLVRSDPVFEIPAERHLGLVVFRLKGPN
CLTESVLKEIAKTGQVFLIPATIQDKLIIRFTVTSQFTTKDDILRDWNLIREAANLVLSQ
HCTSQPSPRAKNLIPPPVTRDSKDLTNGLSLESVNEGGDDPVQVRKIFRLPGDSLETTMD
PFDDCFSEEASDTTKHKLSSFLFSYLSVQNKKKTMRSLSCNSMPMSAQKSPPPDASVKHG
GFFRARIFSGFPEEMMMMKKGGFKKLIKFYSVPSFPECSSQCGTLQLPCCPLQAMV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcccagtgaataccgtgaataccaagctagagggaaagagatggtggattac
atctgccagtacctgagcaccctgcgggagaggcaggtgaccccaaatgtgaagcctggg
tacctgcgagcccagataccttcaagtgctcctgaggaacccgacagctgggatagcatc
tttggggacattgagcaaatcatcatgcctggggtggttcactggcagagcccccacatg
cacgcctactatccggctctcacctcttggccatccctgctaggagatatgctggctgac
gccatcaactgcttggggttcacgtgggcttccagcccggcctgcacagagctggagatg
aacatcatggactggctggcgaagatgctggggctcccggacttcttcctgcaccaccat
cccagcagccaggggggaggcgtcttgcagagcactgtcagcgaatccactttaattgcc
ctgctggcagcaaggaagaacaaaatcctagaaatgaaagcgcatgagcccaatgctgat
gagtcctctctgaacgctcgtcttgttgcctatgcctctgaccaggctcactcttcagtg
gagaaggctggcttgatttcccttgtgaagatcaaatttctgcctgtggatgacaacttc
tcactccgaggagaagctctccagaaggccatcgaggaagacaagcaacagggcttggtg
cctgtgtttgtctgtgcaaccttagggaccactggagtctgtgcatttgataagctgtca
gagctggggcccatctgtgccagggagggactgtggctccacgtcgatgctgcttatgca
ggaacagcctttctgtgccctgagctccggggcttcctgaagggcattgagtacgccgac
tccttcacctttaacccttccaagtggatgatggtgcactttgactgcactgggttctgg
gtcaaggacaagtacaagctacagcagaccttcagtgtgaaccccatctacctcagacat
gcgaactctggtgtcgccactgacttcatgcattggcagatccccttgagccggcgcttt
cgctccattaagctgtggtttgtgattcggtccttcggggtgaagaatcttcaagcacat
gtcagacacggtacagacatggctaaatactttgaatctctggtcaggagcgaccctgtt
ttcgaaattcctgctgagaggcaccttggtctggtggtttttcgtctgaagggtcccaac
tgtctcacagaaagtgtgttaaaggaaatagccaaaactggccaggtcttcctcatccca
gccactatccaggacaagctgatcatccgtttcaccgtgacgtcccagttcaccaccaag
gatgacatcctgagagattggaacctcatccgagaggctgctaaccttgtcctgagccag
cactgcacttctcagccgagccctcgggccaagaaccttattccaccgccggtgaccaga
gactccaaagacctgaccaatgggctatccctggagtctgtcaacgagggaggagatgac
ccagtacaggtccggaagatcttcaggctgccaggagacagtctggaaacgacaatggat
ccctttgatgattgcttctcagaagaggcctccgataccaccaagcacaagctgtcgtcc
tttctgttcagttacttgtcggtacagaacaagaagaagacaatgcggtccctcagctgc
aacagtatgcctatgagtgcccagaagtcacctcccccagatgcttccgtgaagcatggg
ggcttcttccgggccagaatcttttctgggttcccagaagaaatgatgatgatgaagaaa
ggtggcttcaaaaagctgatcaagttctacagtgttcccagctttcctgaatgcagctct
cagtgtggtaccctccagctgccctgctgccctctgcaggccatggtgtag

DBGET integrated database retrieval system