KEGG   Rattus norvegicus (rat): 24448Help
Entry
24448             CDS       T01003                                 

Gene name
Hrh1, Hisr
Definition
(RefSeq) histamine receptor H 1
  KO
K04149  histamine receptor H1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24448 (Hrh1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24448 (Hrh1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24448 (Hrh1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24448 (Hrh1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    24448 (Hrh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 24448
NCBI-ProteinID: NP_058714
RGD: 2830
Ensembl: ENSRNOG00000007420
UniProt: P31390
Position
4q42
AA seq 486 aa AA seqDB search
MSFANTSSTFEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLRYRTKTRASATILGAWFFSFLWVIPILGWHHFMPPAPELREDKC
ETDFYNVTWFKIMTAIINFYLPTLLMLWFYVKIYKAVRRHCQHRQLTNGSLPSFSELKLR
SDDTKEGAKKPGRESPWGVLKRPSRDPSVGLDQKSTSEDPKMTSPTVFSQEGERETRPCF
RLDIMQKQSVAEGDVRGSKANDQALSQPKMDEQSLNTCRRISETSEDQTLVDQQSFSRTT
DSDTSIEPGPGRVKSRSGSNSGLDYIKITWKRLRSHSRQYVSGLHLNRERKAAKQLGFIM
AAFILCWIPYFIFFMVIAFCKSCCSEPMHMFTIWLGYINSTLNPLIYPLCNENFKKTFKK
ILHIRS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgccaatacctcctctaccttcgaagacaagatgtgtgaggggaacaggaca
gccatggccagccctcagctgctgcccctggtggtggttctcagtagtatctccctggtc
acagtgggcctcaacctgctggtgctgtacgctgtgcacagtgaacgcaagctacacacc
gtgggcaacctatacattgtcagcctgtctgtggcagacctgattgtaggggcagttgtc
atgcccatgaacatcctctatctcatcatgactaagtggtccttgggccgccccctctgc
ctcttttggctttctatggattatgtggccagcacagcatccatctttagcgtcttcatc
ctgtgtattgatcgctaccgctccgtccagcaacccctccggtacctgaggtaccgaacc
aagacccgggcttccgctaccatcctgggggcctggttcttctccttcctgtgggttata
cccatacttggctggcatcacttcatgcccccagccccagagcttcgggaagacaagtgt
gagacagacttctacaatgtcacttggttcaagatcatgactgctattattaacttctac
ctccccactttgcttatgctgtggttctatgtgaagatctacaaggctgtgcggcgacac
tgtcagcaccgccagctcaccaacgggtccctcccttccttttcagaactcaagctgagg
tcagacgataccaaggaaggtgccaagaaacctgggagagagtctccctggggggttctg
aaaaggccatcaagagaccccagtgtaggactggatcagaagtcaacatctgaagacccc
aagatgacctctccaactgtcttcagccaagagggggaaagggaaacacgtccctgtttc
cgtctcgacatcatgcagaaacagtctgtggctgagggagatgtcaggggctcaaaggcc
aatgatcaggccttgagccagcccaaaatggatgagcagagcctgaatacttgtcggcgg
atcagtgagacatcagaggatcagaccttggtggatcaacagtccttctcccggaccaca
gactcagacacaagcatagagccagggccgggcagagtcaaatcgagaagcgggtctaac
agtggcctggattacatcaaaatcacctggaagaggctccgctcacactccagacagtat
gtgtccgggctgcacttgaaccgagagcggaaggcagccaagcagttgggttttatcatg
gcggccttcattctctgctggattccctatttcatcttcttcatggtcattgccttctgc
aagagctgctgcagtgaacccatgcatatgttcaccatttggctgggctacatcaactcc
acgctgaaccccctcatctaccccctgtgcaacgagaacttcaagaagacattcaaaaag
attctgcacattcgttcctaa

DBGET integrated database retrieval system