KEGG   Rattus norvegicus (rat): 24450
Entry
24450             CDS       T01003                                 

Gene name
Hmgcs2, Hmgcs1, Mt3h3mg
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA synthase 2
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00072  Synthesis and degradation of ketone bodies
rno00280  Valine, leucine and isoleucine degradation
rno00650  Butanoate metabolism
rno00900  Terpenoid backbone biosynthesis
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
Module
rno_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    24450 (Hmgcs2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    24450 (Hmgcs2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    24450 (Hmgcs2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    24450 (Hmgcs2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    24450 (Hmgcs2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     24450 (Hmgcs2)
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Other DBs
NCBI-GeneID: 24450
NCBI-ProteinID: NP_775117
RGD: 2804
Ensembl: ENSRNOG00000019120
UniProt: P22791
Position
2q34
AA seq 508 aa
MQRLLAPARRVLQVKRVMQESSLSPAHLLPAAQQRFSTIPPAPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKFNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERTKLP
WDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSYWDGRYALVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLVLEQGLRGTHMENAYD
FYKPNLASEYPLVDGKLSIQCYLRALDRCYAAYRRKIQNQWKQAGNNQPFTLDDVQYMIF
HTPFCKMVQKSLARLMFNDFLSSSSDKQNNLYKGLEAFKGLKLEETYTNKDVDKALLKAS
LDMFNKKTKASLYLSTNNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSKDASPGSPLEKLVSSVSDLPKRLDSRRRMSPEEFTEIMNQREQFYHKVNFSPPG
DTSNLFPGTWYLERVDEMHRRKYARRPV
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgcagcggcttttggctccagcaaggcgggtcctgcaagtgaagagagtgatgcaggaa
tcttcgctctcacccgctcacctgctccccgcagcccagcagaggttttctacaatccct
cctgctcccctggccaaaactgatacatggccaaaagatgtgggcatccttgccctggag
gtctactttccagcccaatatgtggaccaaactgacctggagaagttcaacaatgtggaa
gcagggaagtacacagtgggcttgggccagacccgtatgggcttctgttcggtccaggag
gacatcaactccctgtgcctcacagtggtgcagaggctgatggaacgcacaaagctgcca
tgggatgccgtaggccgcctggaagtgggcacggaaaccatcattgacaagtccaaggct
gtcaagacagtgctcatggagctcttccaggattcaggcaacactgacatcgagggcata
gataccaccaacgcctgctatggtggcactgcctccctcttcaacgctgccaactggatg
gagtccagctactgggatggtcgctatgccctggtggtctgtggtgatatcgcagtctac
ccaagtggtaacgcccgccccacaggtggtgccggggctgtggcaatgctgattgggccc
aaggccccgctagtcctggaacaagggctgaggggaacccacatggagaacgcctatgac
ttctacaaaccaaacttggcctcagagtatccactggtggatgggaagctgtctatccag
tgctacctgcgggccttggaccgatgctatgcagcttaccgcaggaaaatccagaatcag
tggaagcaagctggaaacaaccagcctttcaccctcgatgacgtgcaatatatgatcttc
cacacacccttttgcaagatggtccagaaatccctagctcggctgatgttcaatgacttc
ctgtcatctagcagtgacaagcagaacaacttatacaagggtctagaggccttcaagggt
ctaaagctggaagaaacctacaccaacaaggatgttgacaaggctctgctgaaggcctcc
ctggacatgttcaacaagaaaaccaaggcctccctttacctctccacaaacaatgggaac
atgtacacctcgtccctctacgggtgcctggcctcacttctctcccaccactctgcccaa
gaattggccggctccaggattggagcattctcctacggctcaggcttagcagcaagtttc
ttctcatttcgagtgtccaaggacgcttccccaggttcccctctggagaagctggtgtct
agtgtgtcagatctgcccaaacgtctagactcccggagacgcatgtcccctgaggaattc
acagaaataatgaatcagagagagcaattttaccacaaggtgaacttctctccccctggt
gacacaagcaacctcttcccaggcacttggtaccttgaacgagtggatgagatgcaccgc
agaaaatatgcccggcgtcccgtctaa

DBGET integrated database retrieval system