KEGG   Rattus norvegicus (rat): 24457Help
Entry
24457             CDS       T01003                                 

Gene name
Hoxb8, Hox2r1a
Definition
(RefSeq) homeo box B8
  KO
K09308  homeobox protein HoxB/C/D8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24457 (Hoxb8)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    24457 (Hoxb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN MRP-63
Motif
Other DBs
NCBI-GeneID: 24457
NCBI-ProteinID: NP_001178578
RGD: 1586211
Ensembl: ENSRNOG00000007585
UniProt: G3V6Y1
Position
10q26
AA seq 243 aa AA seqDB search
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHG
PSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGE
EAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVS
HALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEKLERAPETAEQGDAQKG
DKK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttatttcgtcaactcactgttctccaaatacaaaaccggggagtccctgcgc
cccaattattatgactgcggcttcgcccaggacctgggcggccgacccaccgtggtgtac
ggtcccagcagcggcggcagcttccagcacccttcgcaaatccaggagttctaccacggg
ccatcgtcgctgtccacggctccctaccagcagaacccgtgcgccgtggcgtgccacggg
gacccgggcaacttctacggctacgaccctctgcagcgccagagcctgttcggtgcgcag
gatccagacctggtgcagtacgcagactgcaagctcgcggcagccagcggcctgggcgag
gaggccgaggggtctgagcagagcccgtcgcccacacagctcttcccctggatgcgccct
caagcagccgccggacgcaggcgaggccgccagacctacagccgctaccagaccctggag
ctggagaaggagttcctatttaatccctatctgactcgcaagcggaggatcgaggtatcg
cacgcgctgggactgacagaaagacaggtcaaaatctggttccagaatcggagaatgaag
tggaaaaaggagaacaacaaagacaagttccccagcagtaaatgcgagcaggaggagctg
gagaaagagaagctggagcgggcgccagagaccgccgagcagggcgatgcgcagaagggt
gacaaaaagtag

DBGET integrated database retrieval system