KEGG   Rattus norvegicus (rat): 24464
Entry
24464             CDS       T01003                                 

Gene name
Hp, Ba1-647
Definition
(RefSeq) haptoglobin
  KO
K16142  haptoglobin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24464 (Hp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24464 (Hp)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   24464 (Hp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   24464 (Hp)
SSDB
Motif
Pfam: Trypsin
Other DBs
NCBI-GeneID: 24464
NCBI-ProteinID: NP_036714
RGD: 2825
Ensembl: ENSRNOG00000014964
UniProt: P06866
Position
19q12
AA seq 347 aa
MRALGAVVTLLLWGQLFAVELGNDATDIEDDSCPKPPEIANGYVEHLVRYRCRQFYKLQT
EGDGIYTLNSEKQWVNPAAGDKLPKCEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKM
ISRHGLTTGATLISDQWLLTTAQNLFLNHSENATAKDIAPTLTLYVGKNQLVEIEKVVLH
PERSVVDIGLIKLKQKVLVTEKVMPICLPSKDYVAPGRMGYVSGWGRNVNFRFTERLKYV
MLPVADQEKCELHYEKSTVPEKKGAVSPVGVQPILNKHTFCAGLTKYEEDTCYGDAGSAF
AVHDTEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagagccctgggagctgtcgtcactctcctgctctggggtcagctttttgctgtggaa
ttgggcaatgatgccacagacattgaagatgacagctgcccaaagcccccagagattgca
aacggctatgtggaacacttggttcgttatcgctgccgacagttctacaaactacagacc
gaaggagatggaatctacaccttaaacagtgagaagcaatgggtgaacccagctgctggc
gataaactccccaagtgtgaggcagtgtgtgggaagcccaagcatcctgtggaccaggta
cagcgcatcatcggtggttccatggacgccaaaggcagctttccttggcaggccaagatg
atctccagacatggactcaccactggggccacactgatcagtgaccagtggctgctgacc
actgcccaaaacctcttcctgaatcacagtgagaatgcgacagccaaggacattgcccct
accttaacactctatgtggggaaaaaccagctggtggagattgagaaggtagttctccac
cccgagcgctctgtggtggatatcgggctgatcaagctcaaacagaaagtgcttgtcact
gagaaagtcatgcctatctgcctgccttccaaagactacgtagcgccaggccgcatgggc
tatgtgtccggttgggggcggaatgtcaactttagatttactgaacgtctcaagtatgtc
atgctgcctgtggctgaccaggagaagtgtgagctgcactatgagaaaagcacagtgcct
gagaagaaaggcgctgtaagtcctgttggggtacagcccatcttgaataagcataccttc
tgtgctggccttaccaagtatgaggaagacacttgctatggtgacgctggcagtgccttt
gccgtccatgacacggaggaggacacctggtatgcagctgggatcctgagctttgacaag
agttgtgccgtagctgagtatggtgtgtacgtgagggcaactgatctgaaggactgggtc
caggaaacaatggccaagaactag

DBGET integrated database retrieval system