KEGG   Rattus norvegicus (rat): 24465
Entry
24465             CDS       T01003                                 

Gene name
Hprt1, Hgprtase, Hprt
Definition
(RefSeq) hypoxanthine phosphoribosyltransferase 1
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24465 (Hprt1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    24465 (Hprt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     24465 (Hprt1)
SSDB
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Other DBs
NCBI-GeneID: 24465
NCBI-ProteinID: NP_036715
RGD: 2826
Ensembl: ENSRNOG00000048561
UniProt: P27605
Position
Xq37
AA seq 218 aa
MSTLSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVG
FEIPDKFVVGYALDYNEHFRDLNHVCVISESGKAKYKA
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtcgaccctcagtcccagcgtcgtgattagtgatgatgaaccaggttatgacctagat
ttattttgcatacctaatcattatgctgaagatttggaaaaggtgtttattcctcatgga
ctgattatggacaggactgaaagacttgctcgagatgtcatgaaggagatgggaggccat
cacattgtggccctctgtgtgctgaaggggggctataagttctttgctgacctgctggat
tacattaaagcgctgaatagaaatagtgataggtccattcctatgactgtagattttatc
agactgaagagctactgtaatgaccagtcaacgggggacataaaagttattggtggagat
gatctctcaactttaactggaaagaacgtcttgattgttgaagatataattgacactggt
aaaacaatgcagactttgctttccttggtcaagcagtacagccccaaaatggttaaggtt
gcaagcttgctggtgaaaaggacctctcgaagtgttggatacaggccagactttgttgga
tttgaaattccagacaagtttgttgttggatatgcccttgactataatgagcacttcagg
gatttgaatcatgtttgtgtcatcagcgaaagtggaaaagccaagtacaaagcctaa

DBGET integrated database retrieval system