KEGG   Rattus norvegicus (rat): 24468Help
Entry
24468             CDS       T01003                                 

Gene name
Hspa8, Hsc70
Definition
(RefSeq) heat shock protein family A (Hsp70) member 8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno04010  MAPK signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04144  Endocytosis
rno04213  Longevity regulating pathway - multiple species
rno04612  Antigen processing and presentation
rno04915  Estrogen signaling pathway
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    24468 (Hspa8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    24468 (Hspa8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24468 (Hspa8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24468 (Hspa8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    24468 (Hspa8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24468 (Hspa8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    24468 (Hspa8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    24468 (Hspa8)
  09172 Infectious disease: viral
   05162 Measles
    24468 (Hspa8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24468 (Hspa8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24468 (Hspa8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    24468 (Hspa8)
   03009 Ribosome biogenesis [BR:rno03009]
    24468 (Hspa8)
   03110 Chaperones and folding catalysts [BR:rno03110]
    24468 (Hspa8)
   04131 Membrane trafficking [BR:rno04131]
    24468 (Hspa8)
   03051 Proteasome [BR:rno03051]
    24468 (Hspa8)
   03029 Mitochondrial biogenesis [BR:rno03029]
    24468 (Hspa8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24468 (Hspa8)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     24468 (Hspa8)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    24468 (Hspa8)
 Complex C
   Prp19-CDC5 complex
    24468 (Hspa8)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    24468 (Hspa8)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP70 / DNAK
   24468 (Hspa8)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    24468 (Hspa8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    24468 (Hspa8)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    24468 (Hspa8)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    24468 (Hspa8)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24468 (Hspa8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 24468
NCBI-ProteinID: NP_077327
RGD: 621725
Ensembl: ENSRNOG00000034066
UniProt: P63018
Structure
PDB: 

Position
8q22
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIISWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatcttggcaccacctactcctgtgtgggtgtc
ttccagcatggaaaggtggaaataattgccaatgaccagggtaaccgcaccacgccgagc
tatgttgctttcaccgacacagaacgattaattggggatgcggccaagaatcaggttgca
atgaaccccaccaacacagtttttgatgccaaacgtctgatcggacgtaggttcgatgat
gctgttgttcagtctgacatgaagcactggcccttcatggtggtgaacgatgcaggcagg
cccaaggtccaagtcgaatacaaaggggagacaaaaagtttctatcctgaggaagtgtct
tcaatggttctgacaaaaatgaaggaaattgcagaagcttaccttggaaagactgttacc
aatgccgtggtcaccgtgccagcttacttcaatgactctcagcgacaggcaacaaaagat
gctggaactattgctggcctcaacgtacttcgaattatcaatgagccaactgctgctgct
attgcctatggcttagataagaaggtcggggctgaaaggaatgtgctcatttttgacttg
ggaggtggcacttttgatgtgtcaatcctcactatcgaggatggaatttttgaagtcaaa
tcaacagctggagacacccacttgggcggagaagactttgacaaccgaatggtcaaccat
ttcattgctgagtttaagcgaaagcacaagaaggacatcagtgagaacaagagagctgtc
aggcgtctccgcactgcctgtgagcgggccaagcgcaccctctcctccagcacccaggcc
agtattgagattgattctctctatgagggaattgacttctacacctccattacccgtgct
cgatttgaggagttgaatgctgacctgttccgtggcacactggaccctgtagagaaggcc
cttcgagatgccaaactagacaagtcacagatccatgatattgtcctggtgggtggttct
accagaatccccaagatccagaaacttctgcaagacttcttcaatggaaaagagctgaat
aagagcattaaccccgatgaagctgttgcctatggtgcagctgtccaggcagccattcta
tctggagacaagtctgagaatgttcaggatttgctgctcttggatgtcactcctctttcc
cttgggattgaaactgctggtggagtcatgactgtcctcatcaagcgcaataccaccatt
cccaccaagcagacccagactttcaccacctactctgacaaccagccaggtgtactcatc
caggtgtatgaaggtgaaagggccatgaccaaggacaacaacctgcttgggaagtttgag
ctcacaggcatacctccagcaccccgtggggttcctcagattgaggttacttttgacatt
gatgccaatggcatcctcaatgtttctgctgtagataagagcacaggaaaggagaacaag
atcaccatcaccaatgacaagggccgcttgagtaaggaggatattgagcgcatggtccaa
gaagctgagaagtacaaagctgaggatgagaagcagagagataaggtttcctctaagaac
tcgctggagtcttatgctttcaacatgaaagcaactgttgaggatgagaaacttcaaggc
aagatcaatgatgaagacaaacagaagattcttgacaagtgcaacgaaatcatcagctgg
ctggataagaaccagactgcggagaaggaagaatttgagcatcagcagaaagaactggag
aaggtctgcaaccctatcatcaccaagctgtaccagagtgctggtggcatgcctggagga
atgcctggtggcttccctggtggaggagctcctccatctggtggtgcttcttcaggcccc
accattgaagaggtcgattaa

DBGET integrated database retrieval system