KEGG   Rattus norvegicus (rat): 24470
Entry
24470             CDS       T01003                                 

Gene name
Hsd3b5, Hsd1, Hsd3b, RATHSDI
Definition
(RefSeq) hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 5
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04913  Ovarian steroidogenesis
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Module
rno_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
rno_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    24470 (Hsd3b5)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    24470 (Hsd3b5)
   04925 Aldosterone synthesis and secretion
    24470 (Hsd3b5)
   04927 Cortisol synthesis and secretion
    24470 (Hsd3b5)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24470 (Hsd3b5)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     24470 (Hsd3b5)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     24470 (Hsd3b5)
SSDB
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd NAD_binding_10 Polysacc_synt_2 NmrA KR RmlD_sub_bind Ldh_1_N DapB_N
Other DBs
NCBI-GeneID: 24470
NCBI-ProteinID: NP_036716
RGD: 2838
Ensembl: ENSRNOG00000019417
UniProt: P27364
Position
2q34
AA seq 373 aa
MPGWSCLVTGAGGFLGQRIVQMLVQEKELQEVRVLYRTFSPKHKEELSKLQTKAKVTVLR
GDIVDAQFLRRACQGMSVIIHTAAALDIAGFLPRQTILDVNVKGTQLLLDACVEASVPAF
IYSSSTGVAGPNSYKETILNDREEEHRESTWSNPYPYSKRMAEKAVLAANGSILKNGGTF
HTCALRLPFIYGEESQIISTMVNRALKNNSIIKRHATFSIANPVYVGNAAWAHILAARGL
RDPEKSQSIQGQFYYISDDTPHQSYDDLNYTLSKEWGFCLDSSWSLPLPLLYWLAFLLET
VSFLLRPFYNYRPPFNRFMVTILNSVFTISYKKAQRDLGYEPLVSWEEAKQKTSEWIGTL
VEQHRETLDTKSQ
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgcctgggtggagctgcctggtgacaggagcaggaggatttctgggccagaggattgtc
caaatgttggtgcaagagaaagagctgcaggaggtcagagtcctgtataggaccttcagt
ccaaaacacaaagaggaactgtccaagctgcagacaaaagccaaggtgacggtactgagg
ggagacattgtggatgcccagttcctgaggagagcgtgccagggcatgtccgtcatcatc
cacaccgctgctgcccttgatatcgcaggcttcctgcccaggcagaccatcctagatgtc
aatgtgaaaggtactcagctcctgttggatgcttgtgtggaagccagcgtaccagccttc
atctacagcagctcaacaggtgtggctggaccaaactcctacaaggagaccatcctgaac
gaccgtgaggaagagcatcgtgaaagcacatggtcaaatccatacccatacagcaaaagg
atggccgagaaggcagtgctggcagccaatgggagcatcctgaaaaatggtggcactttt
catacatgtgccttaagactcccattcatctatggggaagaaagccaaatcatttcaacc
atggtaaatagagcactcaagaacaacagcataattaaaagacatgccacattctccata
gccaacccagtgtatgtgggtaatgcagcctgggcacacattctggctgccaggggcctt
cgagaccccgagaagtcacaaagcatccaaggacagttctactacatctcagatgacacc
cctcaccaaagctatgatgatttaaattataccctgagcaaagaatggggcttctgcctt
gattccagttggagccttcctctgcccctgctctactggcttgccttcctgctggaaact
gtgagcttcctgctgcgtccattttacaactataggccaccctttaaccgcttcatggtc
acgatcttaaatagcgtgtttaccatttcctacaagaaagctcagagagatctgggctat
gagccacttgtcagctgggaggaagccaagcaaaaaacctcggagtggatcgggacacta
gtggagcaacacagggagacactggacacaaagtctcaatga

DBGET integrated database retrieval system