KEGG   Rattus norvegicus (rat): 24471
Entry
24471             CDS       T01003                                 

Gene name
Hspb1
Definition
(RefSeq) heat shock protein beta-1
  KO
K04455  heat shock protein beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04370  VEGF signaling pathway
rno05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24471 (Hspb1)
   04370 VEGF signaling pathway
    24471 (Hspb1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24471 (Hspb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    24471 (Hspb1)
   03110 Chaperones and folding catalysts [BR:rno03110]
    24471 (Hspb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24471 (Hspb1)
Spliceosome [BR:rno03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    24471 (Hspb1)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    24471 (Hspb1)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP20
   24471 (Hspb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24471 (Hspb1)
  Exosomal proteins of breast cancer cells
   24471 (Hspb1)
  Exosomal proteins of bladder cancer cells
   24471 (Hspb1)
SSDB
Motif
Pfam: HSP20 YabP
Other DBs
NCBI-GeneID: 24471
NCBI-ProteinID: NP_114176
RGD: 61306
Ensembl: ENSRNOG00000023546
UniProt: G3V913
Position
12
AA seq 206 aa
MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRFPDEWSQWFSSAGWPGYVRPLP
AATAEGPAAVTLAAPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEG
VVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQS
AEITIPVTFEARAQIGGPESEQSGAK
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaccgagcgccgcgtgcccttctcgctactgcggagccccagctgggagccgttccgg
gactggtaccctgcccacagccgcctcttcgatcaagctttcggggtgcctcggtttccc
gatgagtggtctcagtggttcagctccgctggttggcccggctatgtgcgccctctgccc
gccgcgaccgccgagggccccgcagcagtgaccctggccgcgcccgccttcagccgggcg
ctcaaccggcaactcagcagcggtgtctcagagatccgacagacggccgatcgctggcgc
gtgtccctggacgtcaaccacttcgctcctgaggagctcacagttaagaccaaggaaggc
gtggtggagatcactggcaagcacgaagaaaggcaggatgaacatggctacatctctcgg
tgcttcacccggaaatacacgctccctccaggtgtggaccccaccctggtgtcctcttcc
ctgtcccctgagggcacactcaccgtggaggctccgctgcccaaagcagtcacacaatca
gcggagatcaccattccggtcactttcgaggcccgtgcccaaattggaggcccagagtcg
gaacagtctggagccaagtag

DBGET integrated database retrieval system