KEGG   Rattus norvegicus (rat): 24472
Entry
24472             CDS       T01003                                 

Gene name
Hspa1a, HSP70.1, HSP72, Hsp70-1, Hsp70-2, Hspa1, Hspa1b, Hspa2
Definition
(RefSeq) heat shock 70kD protein 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno04010  MAPK signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04144  Endocytosis
rno04213  Longevity regulating pathway - multiple species
rno04612  Antigen processing and presentation
rno04915  Estrogen signaling pathway
rno05020  Prion disease
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    24472 (Hspa1a)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    24472 (Hspa1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24472 (Hspa1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24472 (Hspa1a)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    24472 (Hspa1a)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    24472 (Hspa1a)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    24472 (Hspa1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    24472 (Hspa1a)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    24472 (Hspa1a)
  09172 Infectious disease: viral
   05162 Measles
    24472 (Hspa1a)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24472 (Hspa1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24472 (Hspa1a)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    24472 (Hspa1a)
   03009 Ribosome biogenesis [BR:rno03009]
    24472 (Hspa1a)
   03110 Chaperones and folding catalysts [BR:rno03110]
    24472 (Hspa1a)
   04131 Membrane trafficking [BR:rno04131]
    24472 (Hspa1a)
   03051 Proteasome [BR:rno03051]
    24472 (Hspa1a)
   03029 Mitochondrial biogenesis [BR:rno03029]
    24472 (Hspa1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24472 (Hspa1a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     24472 (Hspa1a)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    24472 (Hspa1a)
 Complex C
   Prp19-CDC5 complex
    24472 (Hspa1a)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    24472 (Hspa1a)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP70 / DNAK
   24472 (Hspa1a)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    24472 (Hspa1a)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    24472 (Hspa1a)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    24472 (Hspa1a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    24472 (Hspa1a)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24472 (Hspa1a)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Radial_spoke_3 FGGY_C Hydantoinase_A
Other DBs
NCBI-GeneID: 24472
NCBI-ProteinID: NP_114177
RGD: 2840
Ensembl: ENSRNOG00000050647
Vega: OTTRNOG00000001807
UniProt: P0DMW0 P0DMW1
Position
20p12
AA seq 641 aa
MAKKTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVVNDGDKPKVQVNYKGENRSFYPEEIS
SMVLTKMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVSH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEVQRERVAAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDSNTLAEKEEFVHKREELE
RVCNPIISGLYQGAGAPGAGGFGAQAPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggccaagaaaacagcgatcggcatcgacctgggcaccacctactcgtgcgtgggcgtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagc
tacgtggccttcaccgacaccgagcggctcatcggggacgccgccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcccttccaggtggtgaacgacggcgacaag
cccaaggtgcaggtgaactacaagggcgagaaccggtcgttctacccggaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggccacccggtgacc
aacgcggtgatcaccgtgcccgcctacttcaacgactcgcagcggcaggccaccaaggac
gcgggcgtgatcgcgggtctgaacgtgctgcggatcatcaacgagcccacggcggccgcc
atcgcctacgggctggaccggaccggcaagggcgagcgcaacgtgctcatcttcgacctg
gggggcggcacgttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggcgggcgacacgcacctgggcggggaggacttcgacaaccggctggtgagccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgcgcggtg
cggcgactgcgcacggcgtgcgagagggccaagaggacgctgtcgtccagcacccaggcc
agcctggagatcgactctctgttcgagggcatcgacttctacacgtccatcacgcgggcg
cggttcgaggagctgtgctcggacctgttccgcggcacgctggagcccgtggagaaggcc
ctgcgcgacgccaagctggacaaggcgcagatccacgacctggtgctggtgggcggctcg
acgcgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaatccggacgaggcggtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtcggagaacgtgcaggacctgctgctgctggacgtggcgccgctgtcg
ctgggtctggagaccgcgggcggcgtgatgacggcgctcatcaagcgcaactccaccatc
cccaccaagcagacgcagaccttcaccacctactcggacaaccagcccggggtgctgatc
caggtgtacgagggcgagagggccatgacgcgcgacaacaacctgctggggcgcttcgag
ttgagcggcatcccgccggctcccaggggcgtgccccagatcgaggtgaccttcgacatc
gacgccaacggcatcctgaacgtcacggccactgacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggccgagcgctacaaggcggaggacgaggtgcagcgcgagagggtggctgccaagaat
gcgctcgagtcctatgccttcaacatgaagagcgccgtggaggacgagggtctcaagggc
aagatcagcgaggctgacaagaagaaggtgctggacaagtgccaggaggtcatctcctgg
ctggactctaacacgctggctgagaaagaggagttcgtgcacaagcgggaggagctggag
cgggtgtgcaacccgatcatcagcgggctgtatcagggtgcgggtgctcccggggctggg
ggcttcggggcccaggcgcccaagggaggctctgggtcggggcccaccatcgaggaggtg
gattag

DBGET integrated database retrieval system