KEGG   Rattus norvegicus (rat): 24473Help
Entry
24473             CDS       T01003                                 

Gene name
Htr1a, 5HT1A, RAT5HT1A
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04726  Serotonergic synapse
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24473 (Htr1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24473 (Htr1a)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    24473 (Htr1a)
  09157 Sensory system
   04742 Taste transduction
    24473 (Htr1a)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    24473 (Htr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 24473
NCBI-ProteinID: NP_036717
RGD: 2845
Ensembl: ENSRNOG00000010254
UniProt: P19327
Position
2q13
AA seq 422 aa AA seqDB search
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgttcagttttggccagggcaacaacaccacagcgtcccaggagccctttggg
accggcggcaacgttactagcatctccgacgtgaccttcagctaccaagtgatcacctct
ctgttgctgggtactctcattttctgcgcggtgctcggcaatgcctgcgtggttgctgcc
atcgccctggagcgctccctccagaatgtggccaactatctcatcggctccttggcggtt
actgatctcatggtatcagtgctggtgctgcccatggctgctctgtaccaggtgctcaac
aagtggaccctgggccaggtcacctgcgacctgtttatcgccctggatgtactgtgctgc
acctcgtccatcctgcacctgtgcgccatcgcgctagacaggtactgggctatcaccgac
cctatagactatgtgaacaaaaggacgccccggcgcgccgctgcgctgatctcgctcact
tggctcattggctttctcatctccatcccgcccatgctgggctggcgcaccccggaagac
cgatcggaccccgacgcgtgcaccatcagcaaggaccacggctacaccatctactccact
ttcggcgctttctatatcccgctgttgctcatgctggttctctacgggcgcatcttcaga
gccgcacgcttccgaatccgcaagactgtcaggaaggtggaaaagaagggagcaggcacc
agcttaggaacttcgtcggcaccgccccccaagaagagcctgaacggacagccaggtagt
ggggactggaggcgctgtgctgagaacagggcggtggggactccgtgcactaatggggca
gtgaggcagggtgacgacgaggccaccctggaggtgatcgaggtgcaccgagtgggcaac
tccaaagagcaccttcctctgcccagcgagtcaggatctaactcctatgcccccgcctgc
ttggagagaaaaaatgagcgcaatgctgaagcaaagcgcaagatggccttggcccgtgaa
aggaagacggtgaagactctgggcatcatcatgggcaccttcatcctctgctggctgccg
tttttcattgtggctctggtcctgcctttctgtgaaagcagctgccacatgcctgcgttg
ttgggtgccataattaactggctaggctactccaactccctgctcaatccggttatttat
gcttatttcaacaaagactttcaaaacgcttttaagaagataatcaagtgcaagttctgc
cgccgatga

DBGET integrated database retrieval system