KEGG   Rattus norvegicus (rat): 24477
Entry
24477             CDS       T01003                                 

Gene name
Ibsp, Bsp
Definition
(RefSeq) integrin-binding sialoprotein
  KO
K06253  integrin binding sialoprotein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    24477 (Ibsp)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    24477 (Ibsp)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24477 (Ibsp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24477 (Ibsp)
SSDB
Motif
Pfam: BSP_II Presenilin
Other DBs
NCBI-GeneID: 24477
NCBI-ProteinID: NP_036719
RGD: 2855
Ensembl: ENSRNOG00000002158
UniProt: A0JPM6
Position
14p22
AA seq 319 aa
MKTALILLCILGMASAFSMKNFHRRIKAEDSEENGVFKYRPRYFLYKHAYFYPPLKRFPV
QGGSDSSEENGDGDSSEEEGEEEETSNEEENNEDSEGNEDQEAEAENATLSGVTASYGVE
TTADAGKLELAALQLPKKAGDAEGKAPKMKESDEEEEEEEEEENENEEAEVDENEQVVNG
TSTNSTEVDGGNGPSGGDNGEEAEEASVTEAGAEGTTAGARELTSYGTTTAVLLNGFQQT
TPPPEAYGTTSPPARKSSTVEYGEEYEQIGNEYNTAYETYDENNGEPRGDTYRAYEDEYS
YYKGHGYEGYEGQDYYYHQ
NT seq 960 nt   +upstreamnt  +downstreamnt
atgaagactgctttaatcttgctctgcattttggggatggcgagtgctttctcgatgaaa
aatttccatagaagaatcaaagcagaggattctgaagaaaacggggtctttaagtaccgg
ccacgctactttctttataagcatgcctacttttatcctcctctgaaacggtttccagtc
cagggaggcagcgactcttcggaagaaaatggagatggcgatagttcggaggaggagggg
gaggaagaggagacttcaaatgaagaggaaaacaacgaagactctgaggggaatgaagac
caggaggcggaggcagagaacgccacactctcaggggtaaccgctagctacggggtagag
accacagctgacgctggaaagttggagttagctgcgctccagctacccaagaaggctgga
gatgcagagggcaaggctccaaaaatgaaggaaagcgacgaggaagaggaagaggaagag
gaggaagaaaacgagaacgaagaagcagaagtggatgaaaatgagcaggtcgtcaacggc
accagcaccaactccacggaggtggacggggggaatggccccagcggaggagacaacgga
gaagaagccgaggaggcaagcgtcactgaagcaggtgcagaaggaacaacagcaggggcc
agggagctgaccagttatggcaccacgacagctgtccttctgaacgggtttcagcagacg
accccgccacccgaagcctatgggaccacctccccaccagccagaaagagcagcacggtt
gagtatggggaagaatacgaacaaataggcaacgagtacaacactgcgtatgaaacctat
gacgagaacaacggggagcctcgcggggacacttaccgagcttatgaggacgaatacagc
tactacaaggggcatggctatgaaggctacgagggtcaggattattactaccaccagtga

DBGET integrated database retrieval system