KEGG   Rattus norvegicus (rat): 24479Help
Entry
24479             CDS       T01003                                 

Gene name
Idh1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01210  2-Oxocarboxylic acid metabolism
rno01230  Biosynthesis of amino acids
rno04146  Peroxisome
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    24479 (Idh1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    24479 (Idh1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    24479 (Idh1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     24479 (Idh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 24479
NCBI-ProteinID: NP_113698
RGD: 2862
Ensembl: ENSRNOG00000015020
UniProt: P41562
Position
9q32
AA seq 414 aa AA seqDB search
MSRKIHGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGSQKVTYLVHDFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSKFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFANALE
EVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKAKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaaaatccatggcggttctgtggtggaaatgcaaggagatgaaatgacacgg
atcatctgggaattgattaaagaaaagctcattcttccctacgtggaactggatctgcat
agctatgacttaggcatagagaatcgggatgccaccaatgaccaggtcaccaaggatgct
gcggaggctataaagaaatacaacgtcggcgtcaagtgtgctaccatcacccccgatgag
aagagggttgaggagttcaagttgaaacaaatgtggaaatcacccaacggtaccatccgg
aacattctgggcggcactgtcttcagagaagctattatctgcaaaaatatcccccggcta
gtgacaggctgggtaaaacccatcatcattggccgacacgcctatggggaccaatacaga
gcaacagatttcgttgttcctgggcctggaaaagtagagataacctacacaccaaaagat
gggtcgcagaaagtgacatacctggtgcatgactttgaagaaggtggtggtgttgccatg
ggtatgtacaaccaggataagtcaattgaagattttgcacacagttccttccaaatggct
ctgtcgaagggctggcctttgtatctaagcaccaagaacactattctgaagaagtatgat
ggacgcttcaaagacatcttccaggagatctatgacaagcaatacaagtccaagtttgaa
gctcagaagatctggtatgaacacaggctcatagatgacatggtggcccaggctatgaaa
tcagaaggaggcttcatctgggcctgtaagaactatgatggtgatgtgcagtcagactca
gtagcccaaggttatggctcccttggcatgatgaccagtgtgctgatttgtccagatggt
aagacggtagaagcagaggctgcccatggcactgtcacacgtcactaccgcatgtaccag
aaaggacaggagacgtccaccaatcccattgcttccatttttgcctggtcccgagggtta
gcccacagagcaaagcttgacaacaatactgagctcagcttctttgcaaatgctttggaa
gaagtctgcattgagaccattgaggctggctttatgactaaggacttggctgcttgcatt
aaaggcttacccaatgtacagcgttctgactacttgaatacatttgagtttatggacaaa
cttggagaaaacttgaaggccaaactagctcaggccaaactttaa

DBGET integrated database retrieval system