KEGG   Rattus norvegicus (rat): 24481
Entry
24481             CDS       T01003                                 

Gene name
Ifnb1
Definition
(RefSeq) interferon beta precursor
  KO
K05415  interferon beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04630  JAK-STAT signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04668  TNF signaling pathway
rno05135  Yersinia infection
rno05142  Chagas disease
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24481 (Ifnb1)
   04668 TNF signaling pathway
    24481 (Ifnb1)
   04151 PI3K-Akt signaling pathway
    24481 (Ifnb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24481 (Ifnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24481 (Ifnb1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    24481 (Ifnb1)
   04621 NOD-like receptor signaling pathway
    24481 (Ifnb1)
   04622 RIG-I-like receptor signaling pathway
    24481 (Ifnb1)
   04623 Cytosolic DNA-sensing pathway
    24481 (Ifnb1)
   04650 Natural killer cell mediated cytotoxicity
    24481 (Ifnb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24481 (Ifnb1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    24481 (Ifnb1)
   05161 Hepatitis B
    24481 (Ifnb1)
   05160 Hepatitis C
    24481 (Ifnb1)
   05171 Coronavirus disease - COVID-19
    24481 (Ifnb1)
   05164 Influenza A
    24481 (Ifnb1)
   05162 Measles
    24481 (Ifnb1)
   05168 Herpes simplex virus 1 infection
    24481 (Ifnb1)
   05163 Human cytomegalovirus infection
    24481 (Ifnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24481 (Ifnb1)
   05169 Epstein-Barr virus infection
    24481 (Ifnb1)
   05165 Human papillomavirus infection
    24481 (Ifnb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24481 (Ifnb1)
   05152 Tuberculosis
    24481 (Ifnb1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24481 (Ifnb1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24481 (Ifnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24481 (Ifnb1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interferons
   24481 (Ifnb1)
SSDB
Motif
Pfam: Interferon YWFCY
Other DBs
NCBI-GeneID: 24481
NCBI-ProteinID: NP_062000
RGD: 2865
Ensembl: ENSRNOG00000006268
UniProt: P70499
Position
5
AA seq 184 aa
MANRWTLHIAFLLCFSTTALSIDYKQLQFRQSTSIRTCQKLLRQLNGRLNLSYRTDFKIP
MEVMHPSQMEKSYTAFAIQVMLQNVFLVFRSNFSSTGWNETIVESLLDELHQQTELLEII
LKEKQEERLTWVTSTTTLGLKSYYWRVQRYLKDKKYNSYAWMVVRAEVFRNFSIILRLNR
NFQN
NT seq 555 nt   +upstreamnt  +downstreamnt
atggccaacaggtggaccctccacattgcgttcctgctgtgcttctccaccactgccctc
tccatcgactacaagcagctccagttccgacaaagcactagcattcggacatgtcagaag
ctcctgaggcagctgaatggaaggctcaacctcagctacaggacggacttcaagatccct
atggaggtgatgcacccgtcacagatggagaagagttacactgcctttgccattcaagtg
atgctccagaatgtctttcttgtcttcagaagcaatttctccagcactgggtggaatgag
actattgttgaaagtctcttggatgaactacatcagcagacagagcttctggagataata
ctaaaggaaaagcaagaggaaagattgacttgggtgacatccacgactactttaggcttg
aagagctattactggagggtacaaaggtaccttaaagacaagaagtacaacagctatgcc
tggatggtggtccgagcagaagtcttcaggaacttttccattattctaagacttaataga
aacttccagaactga

DBGET integrated database retrieval system