KEGG   Rattus norvegicus (rat): 24482
Entry
24482             CDS       T01003                                 

Gene name
Igf1
Definition
(RefSeq) insulin-like growth factor I isoform d preproprotein
  KO
K05459  insulin-like growth factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04114  Oocyte meiosis
rno04115  p53 signaling pathway
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04935  Growth hormone synthesis, secretion and action
rno04960  Aldosterone-regulated sodium reabsorption
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05410  Hypertrophic cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24482 (Igf1)
   04014 Ras signaling pathway
    24482 (Igf1)
   04015 Rap1 signaling pathway
    24482 (Igf1)
   04066 HIF-1 signaling pathway
    24482 (Igf1)
   04068 FoxO signaling pathway
    24482 (Igf1)
   04151 PI3K-Akt signaling pathway
    24482 (Igf1)
   04152 AMPK signaling pathway
    24482 (Igf1)
   04150 mTOR signaling pathway
    24482 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24482 (Igf1)
   04115 p53 signaling pathway
    24482 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24482 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    24482 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    24482 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    24482 (Igf1)
   04935 Growth hormone synthesis, secretion and action
    24482 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24482 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    24482 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24482 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    24482 (Igf1)
   04213 Longevity regulating pathway - multiple species
    24482 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24482 (Igf1)
   05202 Transcriptional misregulation in cancer
    24482 (Igf1)
   05205 Proteoglycans in cancer
    24482 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    24482 (Igf1)
   05218 Melanoma
    24482 (Igf1)
   05215 Prostate cancer
    24482 (Igf1)
   05224 Breast cancer
    24482 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24482 (Igf1)
   05414 Dilated cardiomyopathy
    24482 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24482 (Igf1)
   01522 Endocrine resistance
    24482 (Igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24482 (Igf1)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24482 (Igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 24482
NCBI-ProteinID: NP_001075948
RGD: 2868
Ensembl: ENSRNOG00000004517
UniProt: P08025 Q5RK13
Position
7
AA seq 153 aa
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSARS
IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggggaaaatcagcagtcttccaactcaattatttaagatctgcctctgtgacttcttg
aagataaagatacacatcatgtcgtcttcacatctcttctacctggcactctgcttgctc
acctttaccagctcggccacagccggaccagagaccctttgcggggctgagctggtggac
gctcttcagttcgtgtgtggaccaaggggcttttacttcaacaagcccacaggctatggc
tccagcattcggagggcaccacagacgggcattgtggatgagtgttgcttccggagctgt
gatctgaggaggctggagatgtactgtgctccgctgaagcctacaaagtcagctcgttcc
atccgggcccagcgccacactgacatgcccaagactcagaaggaagtacacttgaagaac
acaagtagaggaagtgcaggaaacaagacctacagaatgtag

DBGET integrated database retrieval system