KEGG   Rattus norvegicus (rat): 24483
Entry
24483             CDS       T01003                                 

Gene name
Igf2, IGFII, RNIGF2
Definition
(RefSeq) insulin-like growth factor 2
  KO
K13769  insulin-like growth factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24483 (Igf2)
   04014 Ras signaling pathway
    24483 (Igf2)
   04151 PI3K-Akt signaling pathway
    24483 (Igf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24483 (Igf2)
   05205 Proteoglycans in cancer
    24483 (Igf2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24483 (Igf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24483 (Igf2)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24483 (Igf2)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24483 (Igf2)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   24483 (Igf2)
SSDB
Motif
Pfam: IGF2_C Insulin
Other DBs
NCBI-GeneID: 24483
NCBI-ProteinID: NP_001177091
RGD: 2870
Ensembl: ENSRNOG00000020369
UniProt: P01346 M9NW49
Position
1q41
AA seq 180 aa
MGIPVGKSMLVLLISLAFALCCIAAYRPSETLCGGELVDTLQFVCSDRGFYFSRPSSRAN
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAVLPDDFPRYPVGKFFKFDTWR
QSAGRLRRGLPALLRARRGRMLAKELEAFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ
NT seq 543 nt   +upstreamnt  +downstreamnt
atggggatcccagtggggaagtcgatgttggtgcttctcatctctttggccttcgccttg
tgctgcatcgctgcttaccgccccagcgagactctgtgcggaggggagcttgttgacacg
cttcagtttgtctgttcggaccgcggcttctacttcagcaggccttcaagccgtgccaac
cgtcgcagccgtggcatcgtggaagagtgctgcttccgcagctgcgacttggccctcctg
gagacatactgtgccacccccgccaagtccgagagggacgtgtctacctctcaggccgta
cttccggacgacttccccagataccccgtgggcaagttcttcaaattcgacacctggaga
cagtccgcgggacgcctgcgcagaggcctgcctgccctcctgcgtgcccgccggggtcgc
atgcttgccaaagagctcgaagcgttcagagaggccaagcgccaccgtcccctgatcgtg
ttaccacccaaagaccccgcccacgggggagcctcttcggagatgtccagcaaccatcag
tga

DBGET integrated database retrieval system