KEGG   Rattus norvegicus (rat): 24484
Entry
24484             CDS       T01003                                 

Gene name
Igfbp3
Definition
(RefSeq) insulin-like growth factor-binding protein 3 precursor
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno04935  Growth hormone synthesis, secretion and action
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    24484 (Igfbp3)
   04218 Cellular senescence
    24484 (Igfbp3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    24484 (Igfbp3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    24484 (Igfbp3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24484 (Igfbp3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24484 (Igfbp3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    24484 (Igfbp3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   24484 (Igfbp3)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 24484
NCBI-ProteinID: NP_036720
RGD: 2874
Ensembl: ENSRNOG00000061910
UniProt: P15473 A1A5Q9
Position
14
AA seq 292 aa
MHPARPALWAAALTALTLLRGPPVARAGAGAVGAGPVVRCEPCDARALAQCAPPPTAPAC
TELVREPGCGCCLTCALREGDACGVYTERCGTGLRCQPRPAEQYPLKALLNGRGFCANAS
AASSLSAYLPSQPSPGNTTESEEDHNAGSVESQVVPSTHRVTDSKFHPLHSKMEVIIKGQ
ARDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPN
CDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDTKGKDDVHCLSVQSQ
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcatcccgcgcgccccgcgctctgggcggctgcgctcaccgccctcactctgctccgc
ggaccgccagtggcgcgggccggcgcgggcgcggtgggcgcgggccccgtggtgcgctgc
gaaccgtgcgacgcgcgtgcgctggcccagtgcgcgcctccgcccaccgcgcccgcgtgc
acggagctggtgcgagaacccggctgcggctgctgcctgacttgcgcgctgcgcgaaggc
gacgcgtgcggcgtctacacggagcgctgtggcaccggcctccgctgccagccgcgaccg
gccgagcagtatcccctgaaggcgctgctgaatggccgcgggttctgcgccaacgccagc
gccgccagcagcctgagtgcctacctcccctcccagccgtctcctggaaacaccactgag
tctgaggaggaccacaatgctgggagtgtggaaagccaggttgtccccagcacacaccgc
gtgactgattccaagttccatccactccattcaaagatggaggtcatcataaaaggccag
gctagggacagccagcgctacaaagttgactatgagtcccagagcacagacacccagaac
ttctcctccgagtctaagcgggagacagaatatggtccctgccgcagagaaatggaggac
acactgaatcatctgaagttcctcaatgtgctgagtcccaggggcgtccacatcccaaac
tgtgacaagaaggggttctataagaagaaacagtgtcgcccttccaaaggcagaaagcgg
ggcttctgctggtgcgtggacaagtacgggcagccattgccaggctatgacaccaagggg
aaagacgacgtgcattgcctcagcgtgcagagccagtag

DBGET integrated database retrieval system