KEGG   Rattus norvegicus (rat): 24484Help
Entry
24484             CDS       T01003                                 

Gene name
Igfbp3, IGF-BP3
Definition
(RefSeq) insulin-like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
rno04218  Cellular senescence
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    24484 (Igfbp3)
   04218 Cellular senescence
    24484 (Igfbp3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    24484 (Igfbp3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24484 (Igfbp3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   24484 (Igfbp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 24484
NCBI-ProteinID: NP_036720
RGD: 2874
Ensembl: ENSRNOG00000061910
UniProt: P15473 A1A5Q9
Position
14q21
AA seq 292 aa AA seqDB search
MHPARPALWAAALTALTLLRGPPVARAGAGAVGAGPVVRCEPCDARALAQCAPPPTAPAC
TELVREPGCGCCLTCALREGDACGVYTERCGTGLRCQPRPAEQYPLKALLNGRGFCANAS
AASSLSAYLPSQPSPGNTTESEEDHNAGSVESQVVPSTHRVTDSKFHPLHSKMEVIIKGQ
ARDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPN
CDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYDTKGKDDVHCLSVQSQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccgcgcgccccgcgctctgggcggctgcgctcaccgccctcactctgctccgc
ggaccgccagtggcgcgggccggcgcgggcgcggtgggcgcgggccccgtggtgcgctgc
gaaccgtgcgacgcgcgtgcgctggcccagtgcgcgcctccgcccaccgcgcccgcgtgc
acggagctggtgcgagaacccggctgcggctgctgcctgacttgcgcgctgcgcgaaggc
gacgcgtgcggcgtctacacggagcgctgtggcaccggcctccgctgccagccgcgaccg
gccgagcagtatcccctgaaggcgctgctgaatggccgcgggttctgcgccaacgccagc
gccgccagcagcctgagtgcctacctcccctcccagccgtctcctggaaacaccactgag
tctgaggaggaccacaatgctgggagtgtggaaagccaggttgtccccagcacacaccgc
gtgactgattccaagttccatccactccattcaaagatggaggtcatcataaaaggccag
gctagggacagccagcgctacaaagttgactatgagtcccagagcacagacacccagaac
ttctcctccgagtctaagcgggagacagaatatggtccctgccgcagagaaatggaggac
acactgaatcatctgaagttcctcaatgtgctgagtcccaggggcgtccacatcccaaac
tgtgacaagaaggggttctataagaagaaacagtgtcgcccttccaaaggcagaaagcgg
ggcttctgctggtgcgtggacaagtacgggcagccattgccaggctatgacaccaagggg
aaagacgacgtgcattgcctcagcgtgcagagccagtag

DBGET integrated database retrieval system