KEGG   Rattus norvegicus (rat): 24493
Entry
24493             CDS       T01003                                 

Gene name
Il1a, IL-1_alpha, IL-1F1
Definition
(RefSeq) interleukin 1 alpha
  KO
K04383  interleukin 1 alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04217  Necroptosis
rno04218  Cellular senescence
rno04380  Osteoclast differentiation
rno04640  Hematopoietic cell lineage
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04940  Type I diabetes mellitus
rno05010  Alzheimer disease
rno05020  Prion diseases
rno05133  Pertussis
rno05140  Leishmaniasis
rno05152  Tuberculosis
rno05162  Measles
rno05164  Influenza A
rno05321  Inflammatory bowel disease (IBD)
rno05323  Rheumatoid arthritis
rno05332  Graft-versus-host disease
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24493 (Il1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24493 (Il1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24493 (Il1a)
   04218 Cellular senescence
    24493 (Il1a)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24493 (Il1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24493 (Il1a)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    24493 (Il1a)
   05321 Inflammatory bowel disease (IBD)
    24493 (Il1a)
   05332 Graft-versus-host disease
    24493 (Il1a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24493 (Il1a)
   05020 Prion diseases
    24493 (Il1a)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24493 (Il1a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24493 (Il1a)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24493 (Il1a)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24493 (Il1a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24493 (Il1a)
   05152 Tuberculosis
    24493 (Il1a)
  09172 Infectious disease: viral
   05162 Measles
    24493 (Il1a)
   05164 Influenza A
    24493 (Il1a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    24493 (Il1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24493 (Il1a)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   24493 (Il1a)
SSDB
Motif
Pfam: IL1_propep IL1 DUF5645
Other DBs
NCBI-GeneID: 24493
NCBI-ProteinID: NP_058715
RGD: 2890
Ensembl: ENSRNOG00000004575
UniProt: P16598
Position
3q36
AA seq 270 aa
MAKVPDLFEDLKNCYSENEEYSSAIDHLSLNQKSFYDASYGSLHENCTDKFVSLRTSETS
KMSTFTFKESRVVVSATSNKGKILKKRRLSFNQPFTEDDLEAIAHDLEETIQPRSAPHSF
QNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDD
SKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSA
AFPELLIATKEQSQVHLARGLPSMIDFQIS
NT seq 813 nt   +upstreamnt  +downstreamnt
atggccaaagttcctgacttgtttgaagacctaaagaactgctatagtgaaaatgaagaa
tacagttctgccattgaccatctgtctctgaatcagaaatccttctatgatgcaagctat
ggctcacttcatgagaactgcacagataaatttgtatctctgagaacctctgaaacatca
aagatgtccaccttcaccttcaaggagagccgggtggtggtgtcagcaacatcaaacaaa
gggaagattctgaagaagagacggctaagtttcaatcagccctttactgaagatgacctg
gaggccatagcccatgatttagaagagaccatccaacccagatcagcacctcacagcttc
cagaataatttgagatacaaattgataaggatcgtcaagcaggagttcatcatgaatgat
tccctcaaccaaaatatatatgtggatatggacagaatacatctcaaagctgcttcgtta
aatgacctgcagcttgaagtaaaatttgacatgtatgcctactcatcgggaggagacgac
tctaaatatcctgtgactctcaaagtctcaaatactcagctctttgtgagtgctcaggga
gaagacaagcctgtgttgctgaaggagattccggaaacaccaaaactcatcacaggtagt
gagaccgacctcattttcttctgggaaaaaatcaactctaagaactacttcacatccgca
gctttcccagagctgttaattgccacaaaagaacaaagtcaggtgcacctggcacgggga
ctgccctccatgatagatttccagatatcataa

DBGET integrated database retrieval system