KEGG   Rattus norvegicus (rat): 24493
Entry
24493             CDS       T01003                                 

Gene name
Il1a
Definition
(RefSeq) interleukin-1 alpha
  KO
K04383  interleukin 1 alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04217  Necroptosis
rno04218  Cellular senescence
rno04380  Osteoclast differentiation
rno04640  Hematopoietic cell lineage
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04940  Type I diabetes mellitus
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05133  Pertussis
rno05140  Leishmaniasis
rno05152  Tuberculosis
rno05162  Measles
rno05164  Influenza A
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05332  Graft-versus-host disease
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24493 (Il1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24493 (Il1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24493 (Il1a)
   04218 Cellular senescence
    24493 (Il1a)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24493 (Il1a)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24493 (Il1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    24493 (Il1a)
   05162 Measles
    24493 (Il1a)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24493 (Il1a)
   05152 Tuberculosis
    24493 (Il1a)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    24493 (Il1a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24493 (Il1a)
   05321 Inflammatory bowel disease
    24493 (Il1a)
   05332 Graft-versus-host disease
    24493 (Il1a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24493 (Il1a)
   05020 Prion disease
    24493 (Il1a)
   05022 Pathways of neurodegeneration - multiple diseases
    24493 (Il1a)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24493 (Il1a)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24493 (Il1a)
   04932 Non-alcoholic fatty liver disease
    24493 (Il1a)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24493 (Il1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24493 (Il1a)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   24493 (Il1a)
SSDB
Motif
Pfam: IL1_propep IL1 DUF5645
Other DBs
NCBI-GeneID: 24493
NCBI-ProteinID: NP_058715
RGD: 2890
Ensembl: ENSRNOG00000004575
UniProt: P16598
Position
3
AA seq 270 aa
MAKVPDLFEDLKNCYSENEEYSSAIDHLSLNQKSFYDASYGSLHENCTDKFVSLRTSETS
KMSTFTFKESRVVVSATSNKGKILKKRRLSFNQPFTEDDLEAIAHDLEETIQPRSAPHSF
QNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDD
SKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSA
AFPELLIATKEQSQVHLARGLPSMIDFQIS
NT seq 813 nt   +upstreamnt  +downstreamnt
atggccaaagttcctgacttgtttgaagacctaaagaactgctatagtgaaaatgaagaa
tacagttctgccattgaccatctgtctctgaatcagaaatccttctatgatgcaagctat
ggctcacttcatgagaactgcacagataaatttgtatctctgagaacctctgaaacatca
aagatgtccaccttcaccttcaaggagagccgggtggtggtgtcagcaacatcaaacaaa
gggaagattctgaagaagagacggctaagtttcaatcagccctttactgaagatgacctg
gaggccatagcccatgatttagaagagaccatccaacccagatcagcacctcacagcttc
cagaataatttgagatacaaattgataaggatcgtcaagcaggagttcatcatgaatgat
tccctcaaccaaaatatatatgtggatatggacagaatacatctcaaagctgcttcgtta
aatgacctgcagcttgaagtaaaatttgacatgtatgcctactcatcgggaggagacgac
tctaaatatcctgtgactctcaaagtctcaaatactcagctctttgtgagtgctcaggga
gaagacaagcctgtgttgctgaaggagattccggaaacaccaaaactcatcacaggtagt
gagaccgacctcattttcttctgggaaaaaatcaactctaagaactacttcacatccgca
gctttcccagagctgttaattgccacaaaagaacaaagtcaggtgcacctggcacgggga
ctgccctccatgatagatttccagatatcataa

KEGG   Rattus norvegicus (rat): 24494
Entry
24494             CDS       T01003                                 

Gene name
Il1b
Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04640  Hematopoietic cell lineage
rno04657  IL-17 signaling pathway
rno04659  Th17 cell differentiation
rno04668  TNF signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04940  Type I diabetes mellitus
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05144  Malaria
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05332  Graft-versus-host disease
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24494 (Il1b)
   04064 NF-kappa B signaling pathway
    24494 (Il1b)
   04668 TNF signaling pathway
    24494 (Il1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24494 (Il1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    24494 (Il1b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24494 (Il1b)
   04620 Toll-like receptor signaling pathway
    24494 (Il1b)
   04621 NOD-like receptor signaling pathway
    24494 (Il1b)
   04623 Cytosolic DNA-sensing pathway
    24494 (Il1b)
   04625 C-type lectin receptor signaling pathway
    24494 (Il1b)
   04659 Th17 cell differentiation
    24494 (Il1b)
   04657 IL-17 signaling pathway
    24494 (Il1b)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24494 (Il1b)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24494 (Il1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24494 (Il1b)
   05164 Influenza A
    24494 (Il1b)
   05162 Measles
    24494 (Il1b)
   05168 Herpes simplex virus 1 infection
    24494 (Il1b)
   05163 Human cytomegalovirus infection
    24494 (Il1b)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24494 (Il1b)
   05135 Yersinia infection
    24494 (Il1b)
   05133 Pertussis
    24494 (Il1b)
   05134 Legionellosis
    24494 (Il1b)
   05152 Tuberculosis
    24494 (Il1b)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24494 (Il1b)
   05144 Malaria
    24494 (Il1b)
   05140 Leishmaniasis
    24494 (Il1b)
   05142 Chagas disease
    24494 (Il1b)
   05143 African trypanosomiasis
    24494 (Il1b)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24494 (Il1b)
   05321 Inflammatory bowel disease
    24494 (Il1b)
   05332 Graft-versus-host disease
    24494 (Il1b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24494 (Il1b)
   05020 Prion disease
    24494 (Il1b)
   05022 Pathways of neurodegeneration - multiple diseases
    24494 (Il1b)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24494 (Il1b)
   05418 Fluid shear stress and atherosclerosis
    24494 (Il1b)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24494 (Il1b)
   04932 Non-alcoholic fatty liver disease
    24494 (Il1b)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24494 (Il1b)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    24494 (Il1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24494 (Il1b)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24494 (Il1b)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   24494 (Il1b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Cytokines
   24494 (Il1b)
SSDB
Motif
Pfam: IL1 IL1_propep ZinT
Other DBs
NCBI-GeneID: 24494
NCBI-ProteinID: NP_113700
RGD: 2891
Ensembl: ENSRNOG00000004649
UniProt: Q5BKB0
Position
3
AA seq 268 aa
MATVPELNCEIAAFDSEENDLFFEADRPQKIKDCFQALDLGCPDESIQLQISQQHLDKSF
RKAVSLIVAVEKLWQLPMSCPWSFQDEDPSTFFSFIFEEEPVLCDSWDDDDLLVCDVPIR
QLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKG
KNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYIST
SQAEHRPVFLGNSNGRDIVDFTMEPVSS
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcaactgtccctgaactcaactgtgaaatagcagctttcgacagtgaggagaatgac
ctgttctttgaggctgacagaccccaaaagattaaggattgcttccaagcccttgacttg
ggctgtccagatgagagcatccagcttcaaatctcacagcagcatctcgacaagagcttc
aggaaggcagtgtcactcattgtggctgtggagaagctgtggcagctacctatgtcttgc
ccgtggagcttccaggatgaggacccaagcaccttcttttccttcatctttgaagaagag
cccgtcctctgtgactcgtgggatgatgacgacctgctagtgtgtgatgttcccattaga
cagctgcactgcaggcttcgagatgaacaacaaaaatgcctcgtgctgtctgacccatgt
gagctgaaagctctccacctcaatggacagaacataagccaacaagtggtattctccatg
agctttgtacaaggagagacaagcaacgacaaaatccctgtggccttgggcctcaagggg
aagaatctatacctgtcctgtgtgatgaaagacggcacacccaccctgcagctggagagt
gtggatcccaaacaatacccaaagaagaagatggaaaagcggtttgtcttcaacaagata
gaagtcaagaccaaagtggagtttgagtctgcacagttccccaactggtacatcagcacc
tctcaagcagagcacagacctgtcttcctaggaaacagcaatggtcgggacatagttgac
ttcaccatggaacccgtgtcttcctaa

DBGET integrated database retrieval system