KEGG   Rattus norvegicus (rat): 24494Help
Entry
24494             CDS       T01003                                 

Gene name
Il1b, IL-1F2
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01523  Antifolate resistance
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04217  Necroptosis
rno04380  Osteoclast differentiation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04640  Hematopoietic cell lineage
rno04657  IL-17 signaling pathway
rno04659  Th17 cell differentiation
rno04668  TNF signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04940  Type I diabetes mellitus
rno05010  Alzheimer's disease
rno05020  Prion diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05143  African trypanosomiasis
rno05144  Malaria
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex infection
rno05321  Inflammatory bowel disease (IBD)
rno05323  Rheumatoid arthritis
rno05332  Graft-versus-host disease
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    24494 (Il1b)
   04064 NF-kappa B signaling pathway
    24494 (Il1b)
   04668 TNF signaling pathway
    24494 (Il1b)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24494 (Il1b)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    24494 (Il1b)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    24494 (Il1b)
   04620 Toll-like receptor signaling pathway
    24494 (Il1b)
   04621 NOD-like receptor signaling pathway
    24494 (Il1b)
   04623 Cytosolic DNA-sensing pathway
    24494 (Il1b)
   04625 C-type lectin receptor signaling pathway
    24494 (Il1b)
   04659 Th17 cell differentiation
    24494 (Il1b)
   04657 IL-17 signaling pathway
    24494 (Il1b)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24494 (Il1b)
  Development
   04380 Osteoclast differentiation
    24494 (Il1b)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    24494 (Il1b)
   05321 Inflammatiory bowel disease (IBD)
    24494 (Il1b)
   05332 Graft-versus-host disease
    24494 (Il1b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    24494 (Il1b)
   05020 Prion diseases
    24494 (Il1b)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    24494 (Il1b)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    24494 (Il1b)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24494 (Il1b)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24494 (Il1b)
  Infectious diseases
   05132 Salmonella infection
    24494 (Il1b)
   05133 Pertussis
    24494 (Il1b)
   05134 Legionellosis
    24494 (Il1b)
   05152 Tuberculosis
    24494 (Il1b)
   05162 Measles
    24494 (Il1b)
   05164 Influenza A
    24494 (Il1b)
   05168 Herpes simplex infection
    24494 (Il1b)
   05146 Amoebiasis
    24494 (Il1b)
   05144 Malaria
    24494 (Il1b)
   05140 Leishmaniasis
    24494 (Il1b)
   05142 Chagas disease (American trypanosomiasis)
    24494 (Il1b)
   05143 African trypanosomiasis
    24494 (Il1b)
  Drug resistance
   01523 Antifolate resistance
    24494 (Il1b)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   24494 (Il1b)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Cytokines (General comment) Chemotaxis, singal transduction, inflammation
   24494 (Il1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep Inhibitor_I71
Motif
Other DBs
NCBI-GeneID: 24494
NCBI-ProteinID: NP_113700
RGD: 2891
Ensembl: ENSRNOG00000004649
UniProt: Q5BKB0
Position
3q36
AA seq 268 aa AA seqDB search
MATVPELNCEIAAFDSEENDLFFEADRPQKIKDCFQALDLGCPDESIQLQISQQHLDKSF
RKAVSLIVAVEKLWQLPMSCPWSFQDEDPSTFFSFIFEEEPVLCDSWDDDDLLVCDVPIR
QLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKG
KNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYIST
SQAEHRPVFLGNSNGRDIVDFTMEPVSS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgtccctgaactcaactgtgaaatagcagctttcgacagtgaggagaatgac
ctgttctttgaggctgacagaccccaaaagattaaggattgcttccaagcccttgacttg
ggctgtccagatgagagcatccagcttcaaatctcacagcagcatctcgacaagagcttc
aggaaggcagtgtcactcattgtggctgtggagaagctgtggcagctacctatgtcttgc
ccgtggagcttccaggatgaggacccaagcaccttcttttccttcatctttgaagaagag
cccgtcctctgtgactcgtgggatgatgacgacctgctagtgtgtgatgttcccattaga
cagctgcactgcaggcttcgagatgaacaacaaaaatgcctcgtgctgtctgacccatgt
gagctgaaagctctccacctcaatggacagaacataagccaacaagtggtattctccatg
agctttgtacaaggagagacaagcaacgacaaaatccctgtggccttgggcctcaagggg
aagaatctatacctgtcctgtgtgatgaaagacggcacacccaccctgcagctggagagt
gtggatcccaaacaatacccaaagaagaagatggaaaagcggtttgtcttcaacaagata
gaagtcaagaccaaagtggagtttgagtctgcacagttccccaactggtacatcagcacc
tctcaagcagagcacagacctgtcttcctaggaaacagcaatggtcgggacatagttgac
ttcaccatggaacccgtgtcttcctaa

DBGET integrated database retrieval system