KEGG   Rattus norvegicus (rat): 24497
Entry
24497             CDS       T01003                                 

Gene name
Il5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04672  Intestinal immune network for IgA production
rno05200  Pathways in cancer
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease
rno05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24497 (Il5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24497 (Il5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24497 (Il5)
   04660 T cell receptor signaling pathway
    24497 (Il5)
   04658 Th1 and Th2 cell differentiation
    24497 (Il5)
   04657 IL-17 signaling pathway
    24497 (Il5)
   04664 Fc epsilon RI signaling pathway
    24497 (Il5)
   04672 Intestinal immune network for IgA production
    24497 (Il5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24497 (Il5)
  09163 Immune disease
   05310 Asthma
    24497 (Il5)
   05320 Autoimmune thyroid disease
    24497 (Il5)
   05321 Inflammatory bowel disease
    24497 (Il5)
   05330 Allograft rejection
    24497 (Il5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24497 (Il5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24497 (Il5)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   24497 (Il5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Cytokines
   24497 (Il5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 24497
NCBI-ProteinID: NP_068606
RGD: 2900
Ensembl: ENSRNOG00000008111
UniProt: Q9R2C9
Position
10q22
AA seq 132 aa
MRMLLCLNVLTLSCVWAIAMEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQL
CIGEIFQGLDILKNQTVRGGTVEIPFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEF
LGVMSTEWAMEV
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaggatgcttctgtgcttgaacgttctaactctcagctgtgtctgggccattgctatg
gagatccccatgagcacagtggtgaaagagaccttgatacagctgtccactcaccgagct
ctgttgacgagcaatgagacgatgaggcttcctgttcctactcataaaaatcaccagcta
tgcattggagaaatctttcaggggctagacatactgaagaatcaaactgtccgagggggc
actgtggaaataccattccaaaacttgtcattaataaagaaatacattgacggacaaaaa
gagaagtgtggcgaagagaggcggaagaccaggcatttcctggattacctgcaagagttc
cttggcgtgatgagtacagagtgggcaatggaagtctga

DBGET integrated database retrieval system