KEGG   Rattus norvegicus (rat): 24498
Entry
24498             CDS       T01003                                 

Gene name
Il6
Definition
(RefSeq) interleukin-6 precursor
  KO
K05405  interleukin 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01523  Antifolate resistance
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04623  Cytosolic DNA-sensing pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  JAK-STAT signaling pathway
rno04640  Hematopoietic cell lineage
rno04657  IL-17 signaling pathway
rno04659  Th17 cell differentiation
rno04668  TNF signaling pathway
rno04672  Intestinal immune network for IgA production
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05135  Yersinia infection
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05144  Malaria
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05332  Graft-versus-host disease
rno05410  Hypertrophic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    24498 (Il6)
   04668 TNF signaling pathway
    24498 (Il6)
   04066 HIF-1 signaling pathway
    24498 (Il6)
   04068 FoxO signaling pathway
    24498 (Il6)
   04151 PI3K-Akt signaling pathway
    24498 (Il6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    24498 (Il6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    24498 (Il6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    24498 (Il6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    24498 (Il6)
   04620 Toll-like receptor signaling pathway
    24498 (Il6)
   04621 NOD-like receptor signaling pathway
    24498 (Il6)
   04623 Cytosolic DNA-sensing pathway
    24498 (Il6)
   04625 C-type lectin receptor signaling pathway
    24498 (Il6)
   04659 Th17 cell differentiation
    24498 (Il6)
   04657 IL-17 signaling pathway
    24498 (Il6)
   04672 Intestinal immune network for IgA production
    24498 (Il6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24498 (Il6)
   05202 Transcriptional misregulation in cancer
    24498 (Il6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24498 (Il6)
   05161 Hepatitis B
    24498 (Il6)
   05171 Coronavirus disease - COVID-19
    24498 (Il6)
   05164 Influenza A
    24498 (Il6)
   05162 Measles
    24498 (Il6)
   05168 Herpes simplex virus 1 infection
    24498 (Il6)
   05163 Human cytomegalovirus infection
    24498 (Il6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24498 (Il6)
   05169 Epstein-Barr virus infection
    24498 (Il6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24498 (Il6)
   05135 Yersinia infection
    24498 (Il6)
   05133 Pertussis
    24498 (Il6)
   05134 Legionellosis
    24498 (Il6)
   05152 Tuberculosis
    24498 (Il6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    24498 (Il6)
   05144 Malaria
    24498 (Il6)
   05142 Chagas disease
    24498 (Il6)
   05143 African trypanosomiasis
    24498 (Il6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    24498 (Il6)
   05321 Inflammatory bowel disease
    24498 (Il6)
   05332 Graft-versus-host disease
    24498 (Il6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24498 (Il6)
   05020 Prion disease
    24498 (Il6)
   05022 Pathways of neurodegeneration - multiple diseases
    24498 (Il6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    24498 (Il6)
   05410 Hypertrophic cardiomyopathy
    24498 (Il6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    24498 (Il6)
   04931 Insulin resistance
    24498 (Il6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24498 (Il6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24498 (Il6)
   01523 Antifolate resistance
    24498 (Il6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24498 (Il6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   24498 (Il6)
SSDB
Motif
Pfam: IL6 IL23
Other DBs
NCBI-GeneID: 24498
NCBI-ProteinID: NP_036721
RGD: 2901
Ensembl: ENSRNOG00000010278
UniProt: P20607
Position
4
AA seq 211 aa
MKFLSARDFQPVAFLGLMLLTATAFPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLR
EILEMRKELCNGNSDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLLEF
RFYLEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNALLMEKLES
QKEWLRTKTIQLILKALEEFLKVTMRSTRQT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaagtttctctccgcaagagacttccagccagttgccttcttgggactgatgttgttg
acagccactgccttccctacttcacaagtccggagaggagacttcacagaggataccacc
cacaacagaccagtatataccacttcacaagtcggaggcttaattacatatgttctcagg
gagatcttggaaatgagaaaagagttgtgcaatggcaattctgattgtatgaacagcgat
gatgcactgtcagaaaacaatctgaaacttccagaaatacaaagaaatgatggatgcttc
caaactggatataaccaggaaatttgcctattgaaaatctgctctggtcttctggagttc
cgtttctacctggagtttgtgaagaacaacttacaagataacaagaaagacaaagccaga
gtcattcagagcaatactgaaaccctagttcatatcttcaaacaagagataaaagactca
tataaaatagtccttcctaccccaacttccaatgctctcctaatggagaagttagagtca
cagaaggagtggctaaggaccaagaccatccaactcatcttgaaagcacttgaagaattt
ctaaaggtcactatgaggtctactcggcaaacctag

DBGET integrated database retrieval system