KEGG   Rattus norvegicus (rat): 24505
Entry
24505             CDS       T01003                                 

Gene name
Ins1
Definition
(RefSeq) insulin 1
  KO
K04526  insulin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04114  Oocyte meiosis
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04911  Insulin secretion
rno04913  Ovarian steroidogenesis
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04930  Type II diabetes mellitus
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04940  Type I diabetes mellitus
rno04950  Maturity onset diabetes of the young
rno04960  Aldosterone-regulated sodium reabsorption
rno05010  Alzheimer disease
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24505 (Ins1)
   04014 Ras signaling pathway
    24505 (Ins1)
   04015 Rap1 signaling pathway
    24505 (Ins1)
   04066 HIF-1 signaling pathway
    24505 (Ins1)
   04068 FoxO signaling pathway
    24505 (Ins1)
   04072 Phospholipase D signaling pathway
    24505 (Ins1)
   04022 cGMP-PKG signaling pathway
    24505 (Ins1)
   04151 PI3K-Akt signaling pathway
    24505 (Ins1)
   04152 AMPK signaling pathway
    24505 (Ins1)
   04150 mTOR signaling pathway
    24505 (Ins1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24505 (Ins1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    24505 (Ins1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24505 (Ins1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24505 (Ins1)
   04910 Insulin signaling pathway
    24505 (Ins1)
   04923 Regulation of lipolysis in adipocytes
    24505 (Ins1)
   04913 Ovarian steroidogenesis
    24505 (Ins1)
   04914 Progesterone-mediated oocyte maturation
    24505 (Ins1)
   04917 Prolactin signaling pathway
    24505 (Ins1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24505 (Ins1)
  09149 Aging
   04211 Longevity regulating pathway
    24505 (Ins1)
   04213 Longevity regulating pathway - multiple species
    24505 (Ins1)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    24505 (Ins1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24505 (Ins1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    24505 (Ins1)
   04940 Type I diabetes mellitus
    24505 (Ins1)
   04950 Maturity onset diabetes of the young
    24505 (Ins1)
   04932 Non-alcoholic fatty liver disease
    24505 (Ins1)
   04931 Insulin resistance
    24505 (Ins1)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 24505
NCBI-ProteinID: NP_062002
RGD: 2915
Ensembl: ENSRNOG00000012052
UniProt: P01322
Position
1q55
AA seq 110 aa
MALWMRFLPLLALLVLWEPKPAQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVED
PQVPQLELGGGPEAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcttcctgcccctgctggccctgctcgtcctctgggagcccaag
cctgcccaggcttttgtcaaacagcacctttgtggtcctcacctggtggaggctctgtac
ctggtgtgtggggaacgtggtttcttctacacacccaagtcccgtcgtgaagtggaggac
ccgcaagtgccacaactggagctgggtggaggcccggaggccggggatcttcagaccttg
gcactggaggttgcccggcagaagcgtggcattgtggatcagtgctgcaccagcatctgc
tccctctaccaactggagaactactgcaactga

DBGET integrated database retrieval system