KEGG   Rattus norvegicus (rat): 24508
Entry
24508             CDS       T01003                                 

Gene name
Irf1
Definition
(RefSeq) interferon regulatory factor 1
  KO
K09444  interferon regulatory factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04625  C-type lectin receptor signaling pathway
rno04668  TNF signaling pathway
rno04917  Prolactin signaling pathway
rno05133  Pertussis
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    24508 (Irf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    24508 (Irf1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    24508 (Irf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24508 (Irf1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    24508 (Irf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24508 (Irf1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    24508 (Irf1)
SSDB
Motif
Pfam: IRF
Other DBs
NCBI-GeneID: 24508
NCBI-ProteinID: NP_036723
RGD: 2920
Ensembl: ENSRNOG00000008144
UniProt: P23570
Position
10
AA seq 328 aa
MPITRMRMRPWLEMQINSNQIPGLSWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR
KERKSKSSRDTKSKTKRKLCGDSSPDTLSDGLSSSTLPDDHSSYTAQGYLGQDLDMDRDI
TPALSPCVVSSSLSEWHMQMDIMPDSTTDLYNLQVSPMPSTSEAATDEDEEGKLPEDIMK
LFEQSEWQPTHVDGKGYLLNEPGAQLSTVYGDFSCKEEPEIDSPGGDIEIGIQRVFTEMK
NMDPVMWMDTLLGNSTRPPSIQAIPCAP
NT seq 987 nt   +upstreamnt  +downstreamnt
atgcctatcactcggatgcgaatgagaccctggctagagatgcagattaattccaaccaa
attccagggctgagctggatcaataaagaagagatgatcttccagatcccatggaagcat
gctgccaagcacggttgggacatcaacaaggatgcctgtctgttccggagctgggccatt
cacacaggccgatacaaagcaggggaaaaagagccagatcccaagacttggaaggcaaac
ttccggtgtgccatgaactccctaccagacatcgaggaagtgaaggaccagagcaggaac
aagggcagctctgctgtacgcgtgtaccggatgctgccacccctcaccaagaaccagagg
aaagagagaaagtccaagtccagccgtgacactaagagcaaaaccaagaggaagctgtgc
ggagattctagccctgacaccttatctgacggactgagcagctctactctgcctgatgac
cacagcagttacacagctcagggatacctgggtcaggacttggacatggacagggacatt
accccagctctgtcaccgtgcgtcgtcagcagcagtctctctgagtggcatatgcagatg
gacatcatgccagacagcaccactgatctgtacaacttgcaggtgtcgcccatgccctcc
acctctgaagctgcaacagatgaggatgaggaagggaagttacctgaggacatcatgaag
ctctttgaacagtctgagtggcagccgacgcacgtggatggcaagggatacttgctcaat
gaaccaggagcccaactctctactgtctatggagacttcagctgcaaggaggaaccagag
atcgacagccctggaggggacatcgagataggcatacagcgtgtcttcacagagatgaag
aatatggaccccgtcatgtggatggacaccctgctgggcaactctaccaggccgccctcc
attcaggctattccttgtgcaccataa

DBGET integrated database retrieval system