KEGG   Rattus norvegicus (rat): 24511
Entry
24511             CDS       T01003                                 

Gene name
Itgb1
Definition
(RefSeq) integrin beta-1 precursor
  KO
K05719  integrin beta 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04514  Cell adhesion molecules
rno04530  Tight junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05222  Small cell lung cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    24511 (Itgb1)
   04151 PI3K-Akt signaling pathway
    24511 (Itgb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    24511 (Itgb1)
   04514 Cell adhesion molecules
    24511 (Itgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24511 (Itgb1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24511 (Itgb1)
   04530 Tight junction
    24511 (Itgb1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24511 (Itgb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24511 (Itgb1)
   04670 Leukocyte transendothelial migration
    24511 (Itgb1)
  09158 Development and regeneration
   04360 Axon guidance
    24511 (Itgb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24511 (Itgb1)
   05205 Proteoglycans in cancer
    24511 (Itgb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    24511 (Itgb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24511 (Itgb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24511 (Itgb1)
   05133 Pertussis
    24511 (Itgb1)
   05100 Bacterial invasion of epithelial cells
    24511 (Itgb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24511 (Itgb1)
   05140 Leishmaniasis
    24511 (Itgb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24511 (Itgb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    24511 (Itgb1)
   05414 Dilated cardiomyopathy
    24511 (Itgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24511 (Itgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24511 (Itgb1)
   04515 Cell adhesion molecules [BR:rno04515]
    24511 (Itgb1)
   04090 CD molecules [BR:rno04090]
    24511 (Itgb1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    24511 (Itgb1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24511 (Itgb1)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin beta subunits
   24511 (Itgb1)
CD molecules [BR:rno04090]
 Proteins
  24511 (Itgb1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 24511
NCBI-ProteinID: NP_058718
RGD: 2927
Ensembl: ENSRNOG00000010966
UniProt: P49134 A0A0G2JSK5
Position
19
AA seq 798 aa
MNLQLVFWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPT
SARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLL
LKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RENTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTVPCV
ATNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNSNGEAHVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttgcaactggttttctggattggattgatcagcttgatttgttctgtatttggc
caaacagataaaaatagatgtttaaaagcaaatgccaaatcttgtggagaatgtatacaa
gcagggccaaattgtgggtggtgtacaaatacgacatttttacaagaaggaatgcctact
tctgcacgatgtgatgatttagaagctttgaaaaagaagggttgccaaccaagtgacata
gagaatcccagaggctcccaaactataaagaagaataaaaacgtcaccaatcgcagcaaa
gggatggcagagaagctccggccagaagacattactcagatccaaccacaacagctgctt
ctaaagttgcgatcaggagaaccacagaagtttacattaaaattcaagagggctgaagac
taccctattgatctgtactaccttatggatctctcctactctatgaaagatgatctggag
aatgtgaagagtcttgggacggatctgatgaatgaaatgaggaggattacttcagacttc
cgcattggctttggctcatttgtggagaaaactgtgatgccatacattagtacaacacca
gcaaagctaagaaatccttgtacgagtgaacaaaactgtaccagcccatttagctacaaa
aacgtgcttagtcttactgacagaggagagtttttcaatgaacttgttggtcagcagcgc
atatctggaaacttggactctccagaaggtggctttgatgcaatcatgcaggttgcagtt
tgtgggtcgctgattggctggaggaatgtaacacgactgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggtattgttttacccaatgatggccag
tgtcacctggaaaataatgtgtatacaatgagccattactatgattatccttcaattgct
caccttgttcagaaactaagtgaaaataatattcagacgatttttgcagtcactgaagag
ttccagcctgtttacaaggaattgaagaatttgattcctaagtcagcagtgggcacactg
tctggaaactctagtaatgtgatacagctgattatcgatgcctacaattccctttcttca
gaagtcattctggaaaacagcaaattgccagatggagtaacaataaattacaagtcctac
tgcaagaatggagtgaatgggacaggagaaaatggacgaaagtgctctaacatttccatt
ggagatgaggttcaatttgaaattagcataactgctaataaatgtccaaacaaggagtct
gaaacaattaaaattaaacctctgggcttcacagaagaagtagaggtggtccttcagttc
atctgtaagtgtaattgtcaaagccatggcatcccagcaagtcccaagtgccatgaggga
aatgggacatttgagtgtggagcctgcaggtgcaatgagggtcgtgttgggagacactgt
gaatgtagcacagatgaagtgaacagtgaagacatggatgcttactgcagaaaagagaac
agctcagagatctgcagtaacaatggagagtgtgtctgtggacagtgtgtgtgcaggaag
agagagaatacaaatgaaatttactccggcaaattctgcgagtgtgataacttcaactgc
gataggtccaacggcttaatctgtggaggaaatggtgtgtgcaggtgtcgtgtctgtgaa
tgctatcccaactacactggcagtgcatgtgactgttccttggacactgttccatgcgta
gcgacaaatggtcagatctgcaatggccggggcatctgtgaatgtggtgcttgtaagtgc
acagatcccaagttccaagggccaacctgtgagacctgtcagacctgccttggtgtctgt
gcagagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaaaaaagacacg
tgtgcacaggagtgctcccatttcaacctcactaaagtggaaagcagggagaagttgccc
cagcctgtgcaggtggaccctgtgacccactgcaaggagaaggacattgatgactgctgg
ttctatttcacctactcagtgaacagcaacggtgaagctcacgtgcatgttgtggagact
ccagactgtcctactggtcccgacatcatcccaattgtagcaggcgtggttgccggaatt
gttcttattggccttgccttgctgctgatttggaaacttttaatgataattcatgacaga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaagtgggacacgggtgaaaat
cctatttacaagagtgccgtgacaactgtggtcaatccgaagtatgagggaaaatga

KEGG   Rattus norvegicus (rat): 315346
Entry
315346            CDS       T01003                                 

Gene name
Itga5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04640  Hematopoietic cell lineage
rno04810  Regulation of actin cytoskeleton
rno05100  Bacterial invasion of epithelial cells
rno05133  Pertussis
rno05135  Yersinia infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    315346 (Itga5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    315346 (Itga5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    315346 (Itga5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    315346 (Itga5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    315346 (Itga5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    315346 (Itga5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    315346 (Itga5)
   05205 Proteoglycans in cancer
    315346 (Itga5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    315346 (Itga5)
   05165 Human papillomavirus infection
    315346 (Itga5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    315346 (Itga5)
   05133 Pertussis
    315346 (Itga5)
   05100 Bacterial invasion of epithelial cells
    315346 (Itga5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    315346 (Itga5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    315346 (Itga5)
   05414 Dilated cardiomyopathy
    315346 (Itga5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    315346 (Itga5)
   04515 Cell adhesion molecules [BR:rno04515]
    315346 (Itga5)
   04090 CD molecules [BR:rno04090]
    315346 (Itga5)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   315346 (Itga5)
Cell adhesion molecules [BR:rno04515]
 Integrins
  Integrin alpha subunits
   315346 (Itga5)
CD molecules [BR:rno04090]
 Proteins
  315346 (Itga5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 315346
NCBI-ProteinID: NP_001101588
RGD: 2925
Ensembl: ENSRNOG00000057451
UniProt: A0A0G2K1E2
Position
7
AA seq 1099 aa
MPPRQPTRRPGGGPSRELGKLLPALSHSPLGGLGSGSGSVAPGQGRTGAMGSWTPRSPRS
PLHAVLLRWGPRRLPPLLPLLLLLWPPPLQVGGFNLDAEAPAVLSGPPGSLFGFSVEFYR
PGRDGVSVLVGAPKANTSQPGVLQGGAVYVCPWGTSPIQCSTIQFDSKGSRILESSLYSE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKDPQNDPVGTCYLSTENFTRILEYAP
CRSDFGSAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQISESYYPQYLI
NPVQGQLQTRQASSVYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTVLNGSDI
HSLYNVSGEQMASYFGYAVAATDTNGDGLDDLLVGAPLLMERTADGRPQEVGRVYIYLQH
PEGIEPTPSLTLTGQDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGEAQQGVVFIFPGG
PGGLNTKPSQVLQPLWAAGHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKALVYRGRP
IISASASLTIFPSMFNPEERSCSLEGNPVSCINLSFCLNASGKHVPNSIGFEVELQLDWQ
KQKGGVRRALFLASKQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPKAPMDSHGLRPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLAVYGEKKHVYLGDK
NALNLTFLAQNLGEGGAYEAELRVTAPLEAEYSGLVRHPGNFSSLSCDYFAVNQSRQLVC
DLGNPMKAGTSIWGGLRFTVPHLQDTKKTIQFDFQILSKNLNNSQSNMVSFPLSVEAQAQ
VSLNGVSKPEAVIFPVSDWNPQDQPQKEGDLGPAVHHVYELINQGPSSISQGVLEISCPQ
ALEGQQLLYVTKVTGLNNCTSNYTPNSQGLELDPEVSPHHLQRREAPGRSSTTSGTQVLK
CPEAKCFRLRCEFGPLHRQESRSLQLHFRVWAKTFLQQEYQPFSLQCEALYEALKMPYQI
LPRQLPQKKLQVATAVQWTKAEGSNGVPLWIIILAILFGLLLLGLLIYVLYKLGFFKRSL
PYGTAMEKAQLKPPATSDA
NT seq 3300 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccgacccggcggccggggggagggcccagccgggagttgggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagaacgggcgctatggggagctggacgccacggtcgccacgatct
cctctccatgcggtgctgctgcgctgggggccccgacgcctaccgccgctgctgccgctg
ctgctgctactgtggccgccaccactccaggttgggggcttcaacctagacgcggaggcc
ccggcggtgctctccgggccccccggctccctctttggcttctccgtggagttttaccgg
ccgggaagggacggagtcagtgtgctggttggggcacccaaggctaacactagccaacca
ggagtactacaaggtggcgctgtctatgtgtgtccctggggcaccagtcctatccagtgc
agcaccattcaatttgacagcaaaggctcccgcatcctggagtcttcattgtatagtgag
gaacctgtggagtacaagtccttgcagtggttcggggcaacggttcgggcccacggctcc
tccatcttggcatgcgctccactgtatagctggcgcacagaaaaggacccacagaatgac
ccagtgggcacctgctacctctccacagaaaacttcacccggattctggagtatgcacct
tgccgctcagattttggcagtgcagcagggcagggttactgccaagggggcttcagtgcc
gagttcaccaagactggccgcgtggtcctaggaggacctgggagctacttctggcaaggc
cagatcctgtcggccactcaagagcagatctcggagtcctattacccacagtacctcatc
aaccctgttcaggggcagctgcagacccgccaggccagctccgtctatgatgacagctac
ttgggatactctgtggctgtaggtgaattcagtggtgatgacacagaagactttgttgct
ggcgtgcccaaaggaaacctcacctatggctatgtcactgtccttaatggctcagacatc
cactccctctacaacgtctcaggagaacagatggcctcctattttggctatgccgtagct
gccactgataccaatggagatgggctagatgacctgctggtaggggcacccctactcatg
gagcggacagctgacgggagacctcaggaggtgggcagggtctacatctatctgcagcac
ccagagggtatagagcctacgccctccctcaccctcactggccaagatgagttcggccga
ttcggcagctccttgacacccctgggggacctggaccaagacggctacaatgatgtcgcc
attggggctccgtttggtggggaggcccagcaaggagttgtatttatattcccgggaggc
ccaggaggactgaacactaagccttcccaggttttgcagcctctgtgggcagctggccat
accccagacttctttggctctgccctccgaggaggacgagatctggacggcaatggatac
cctgatctaatcgttggatcctttggtgtggacaaggctctggtatacaggggtcggccc
atcatatctgccagtgcgtctctcaccatcttcccctccatgttcaacccagaggagcgc
agctgcagcctggaaggaaaccctgtatcctgcatcaaccttagcttctgcctcaacgcc
tctggaaaacatgtacccaactctataggcttcgaggtggaactccaactggactggcag
aagcagaagggaggggtccggagggcactgttcctggcttccaagcaggccacccttacc
cagaccctgcttatccagaatggggctcgggaggactgcagggagatgaagatctacctc
aggaatgaatcagaattcagagacaaactctccccaattcacattgccctcaacttctcc
ttggaccccaaagcccccatggacagccatggcctccggccagtcctacactaccagagc
aagagccggatagaggacaaggcccagatcttgctagactgtggtgaagacaacatctgt
gtgcctgacctgcagctggctgtgtatggggagaagaaacatgtgtacctgggtgacaag
aacgccctgaacctgacattcctcgcccagaatctgggcgagggtggggcctatgaagcc
gagctgcgggtcacagcccccctggaggctgagtactcggggcttgtcagacacccaggg
aacttctccagcctgagctgtgactacttcgcggtgaaccagagccgccagctggtgtgt
gacctgggcaaccccatgaaggcaggcaccagtatctggggtggccttcggttcactgtt
cctcatcttcaagacacaaagaaaaccatccaatttgacttccagatcctcagcaagaac
ctgaacaactcacaaagcaacatggtctccttcccactctcggtggaggctcaagcccaa
gtctcccttaacggtgtctccaagcctgaagccgtgattttcccagtcagcgactggaat
cctcaagaccagcctcagaaggagggagatttgggccctgctgtccaccatgtctatgag
ctcattaaccaggggcccagctccatcagccagggtgtgctggagatcagctgtccccag
gctctggaaggccaacagctcctctatgtgaccaaggtgacgggactcaacaactgcacc
tccaactacacccccaactcacagggcctggagttggatccagaggtttctccacatcac
ctgcagaggcgagaggctccagggaggagttctaccacctcaggaacacaagtcctgaaa
tgccctgaagccaagtgtttcaggctgcgctgtgagtttgggccactgcatcgccaagag
agccggagtctgcagctgcatttccgagtctgggccaagaccttcttgcagcaggaatac
cagccgttcagccttcagtgtgaggctctatatgaagccctgaagatgccctaccaaatc
ctgcctcggcagctgccccaaaagaaactccaggtggccacagccgtgcagtggaccaag
gcagaaggcagcaatggcgtcccactgtggatcatcatcctcgccatcctttttggcctc
ctgctcctaggtctgctcatctatgtcctctacaagctcggcttcttcaaacgctccctc
ccctacggcacagccatggaaaaagctcagctcaagcctccagccacctcagatgcctga

DBGET integrated database retrieval system