KEGG   Rattus norvegicus (rat): 24533
Entry
24533             CDS       T01003                                 

Gene name
Ldha
Definition
(RefSeq) L-lactate dehydrogenase A chain
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24533 (Ldha)
   00620 Pyruvate metabolism
    24533 (Ldha)
   00640 Propanoate metabolism
    24533 (Ldha)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    24533 (Ldha)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24533 (Ldha)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24533 (Ldha)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    24533 (Ldha)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24533 (Ldha)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     24533 (Ldha)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   24533 (Ldha)
  Exosomal proteins of breast milk
   24533 (Ldha)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Pyr_redox_2 Glyco_hydro_4
Other DBs
NCBI-GeneID: 24533
NCBI-ProteinID: NP_058721
RGD: 2996
Ensembl: ENSRNOG00000013009
UniProt: P04642 B5DEN4
Structure
PDB: 

Position
1
AA seq 332 aa
MAALKDQLIVNLLKEEQVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG
EMMDLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI
IPNVVKYSPQCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV
HPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYE
VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGI
SDVVKVTLTPDEEARLKKSADTLWGIQKELQF
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcagccctcaaggaccagctgattgtgaatcttcttaaggaagaacaggtcccccag
aacaagattacagttgttggggttggtgctgttggcatggcttgtgccatcagtatctta
atgaaggacttggctgatgagcttgcccttgttgatgtcatagaagataagctaaaggga
gagatgatggatcttcagcatggcagccttttccttaagacaccaaaaattgtctccagc
aaagattatagtgtgactgcaaactccaagctggtcattatcaccgcgggggcccgtcag
caagagggagagagccggctcaatttggtccagcgaaacgtgaacatcttcaagttcatc
attccaaatgttgtgaaatacagtccacagtgcaaactgctcatcgtctcaaacccagtg
gatatcttgacctacgtggcttggaagatcagcggcttccccaaaaacagagttattgga
agtggttgcaatctggattcggctcggttccgttacctgatgggagaaaggctgggagtt
catccactgagctgtcacgggtgggtcctgggagagcatggcgactccagtgtgcctgtg
tggagtggtgtgaatgtcgccggcgtctccctgaagtctctgaacccgcagctgggcacg
gatgcagacaaggagcagtggaaggatgtgcacaagcaggtggttgacagtgcatacgaa
gtgatcaagctgaaaggttacacatcctgggccattggcctctccgtggcagacttggcc
gagagcataatgaagaaccttaggcgggtgcatcccatttccaccatgattaagggtctc
tatggaatcaaggaggatgtcttcctcagcgtcccatgtatcctgggacaaaatggaatc
tcagatgttgtgaaggtgacactgactcctgacgaggaggcccgcctgaagaagagtgca
gataccctctggggaatccagaaggagctgcagttctaa

KEGG   Rattus norvegicus (rat): 24534
Entry
24534             CDS       T01003                                 

Gene name
Ldhb
Definition
(RefSeq) L-lactate dehydrogenase B chain isoform Ldhb
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24534 (Ldhb)
   00620 Pyruvate metabolism
    24534 (Ldhb)
   00640 Propanoate metabolism
    24534 (Ldhb)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    24534 (Ldhb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    24534 (Ldhb)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    24534 (Ldhb)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    24534 (Ldhb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24534 (Ldhb)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     24534 (Ldhb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   24534 (Ldhb)
  Exosomal proteins of breast milk
   24534 (Ldhb)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Other DBs
NCBI-GeneID: 24534
NCBI-ProteinID: NP_001303263
RGD: 2997
Ensembl: ENSRNOG00000013000
UniProt: P42123
Position
4
AA seq 334 aa
MATLKEKLIAPVADDETAVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCTIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVDSAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEVAQLRKSADTLWDIQKDLKDL
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcaacccttaaggaaaagctcattgcgccagtcgcagacgacgagactgccgtcccg
aacaacaagattactgtagtaggcgttggacaagttggaatggcttgtgctatcagcatt
ctggggaagtctctggctgatgagcttgccctggtggatgtcttggaagacaagctcaaa
ggagaaatgatggatctgcagcacgggagcttatttctccagactccgaaaatcgtggct
gataaagattactccgtgacagccaattctaagattgtggtggtgaccgcgggagtccgc
cagcaggagggggagagtcggctcaacctggtgcagagaaacgtcaatgtattcaagttc
attattcctcagatcgtcaagtacagccccgactgcaccatcatcgtggtttccaaccca
gtggatattcttacctatgtcacctggaagctgagcgggctacctaagcaccgcgtgatt
ggaagtggatgcaatctggattctgctcggtttcgttacctcatggccgaaaagcttggt
attcatcccagcagctgccacggctggatcctgggcgagcacggggactccagtgtggca
gtgtggagcggggtgaatgtggcaggagtctccctccaggaactgaacccagagatggga
acggacaatgacagcgagaactggaaggaggtgcataagatggtggtggacagtgcctat
gaagtcatcaagctaaaaggctacaccaactgggccatcggcctaagtgtggctgacctc
atcgaatccatgctgaaaaacctctctcggattcaccccgtgtctacaatggtgaaggga
atgtacggcatcgagaacgaagtcttcctcagtctcccgtgcatccttaatgctcgggga
ctgaccagcgtcatcaaccagaagctgaaggacgatgaggtcgctcagctcaggaagagt
gcggacaccctgtgggatatccagaaagacctcaaggacctgtga

KEGG   Rattus norvegicus (rat): 29634
Entry
29634             CDS       T01003                                 

Gene name
Ldhc
Definition
(RefSeq) L-lactate dehydrogenase C chain
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    29634 (Ldhc)
   00620 Pyruvate metabolism
    29634 (Ldhc)
   00640 Propanoate metabolism
    29634 (Ldhc)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    29634 (Ldhc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    29634 (Ldhc)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    29634 (Ldhc)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    29634 (Ldhc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29634 (Ldhc)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     29634 (Ldhc)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   29634 (Ldhc)
  Exosomal proteins of breast milk
   29634 (Ldhc)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C ThiF UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 29634
NCBI-ProteinID: NP_058962
RGD: 69366
Ensembl: ENSRNOG00000013103
UniProt: Q6AYX2
Position
1
AA seq 332 aa
MSTVKEQLIQNLAPDEKQSRCKITVVGVGNVGMACAISILLKGLADELALVDADENKLKG
EALDLLHGSLFLSTPKIVFGKDYSVSANSKLVIITAGARMVSGESRLALLQRNVTIMKAI
VPGVIQNSPDCKIMIVTNPVDILTYVVWKISGLPVSSVIGSGCNLDSARFRYLIGEKLGV
NPSSCHGWVLGEHGDSSVPIWSGVNIAGVTLKSLNPAIGSDSDKEQWKTVHKQVVDGGYE
VLNLKGYTSWAIALSVTDIAASILKNLKRVHAVTTLVKGLYGIKEEIFLSIPCVLGQSGI
TDLVKVNMNTEEEALFKKSCDILWNIQKDLQL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtccactgtcaaggagcagctaattcagaacctagctccagatgaaaaacaatcccgg
tgtaagatcactgtggtcggagttggaaatgtgggcatggcgtgtgccattagtatttta
ctgaagggtctggctgatgaacttgcccttgttgatgctgatgagaacaaactgaaggga
gaggcactggatcttctgcatggcagccttttcctcagcactccaaaaatcgtctttgga
aaagattacagtgtatctgccaactccaaactggttattatcactgctggtgcaagaatg
gtgagtggagaatctcgtcttgccctgctccaacgtaatgtcactatcatgaaagccatc
gttcccggcgtaatccaaaacagtccggactgtaaaataatgattgtcacaaacccagtc
gatattttgacatacgtggtttggaagataagtggcctccctgtaagcagtgtgattgga
agtggctgtaacctagactccgctcgtttccgttacctgattggagagaagctgggtgtc
aacccttcgagctgccatggctgggttcttggagaacatggggactccagtgtgcccata
tggagtggtgtgaacattgctggcgtaactctgaagtcactgaacccagcaataggatcc
gactccgataaggaacagtggaaaaccgttcacaagcaggtggtggatggtggctatgag
gtccttaacctgaagggctatacctcttgggccattgcgctgtctgtgactgatatcgct
gcatcaatcttgaagaatcttaagagggtgcatgctgttactacgctggttaagggctta
tatgggataaaggaagaaatcttcctcagtatcccgtgtgtcttgggacaaagtggcatc
acagaccttgtgaaagtcaacatgaacaccgaggaggaagctctttttaagaagagttgc
gacatactctggaacatccagaaagatctgcaattataa

KEGG   Rattus norvegicus (rat): 369018
Entry
369018            CDS       T01003                                 

Gene name
Ldhal6b
Definition
(RefSeq) L-lactate dehydrogenase A-like 6B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00010  Glycolysis / Gluconeogenesis
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00640  Propanoate metabolism
rno01100  Metabolic pathways
rno04066  HIF-1 signaling pathway
rno04922  Glucagon signaling pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    369018 (Ldhal6b)
   00620 Pyruvate metabolism
    369018 (Ldhal6b)
   00640 Propanoate metabolism
    369018 (Ldhal6b)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    369018 (Ldhal6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    369018 (Ldhal6b)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    369018 (Ldhal6b)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    369018 (Ldhal6b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    369018 (Ldhal6b)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     369018 (Ldhal6b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   369018 (Ldhal6b)
  Exosomal proteins of breast milk
   369018 (Ldhal6b)
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N
Other DBs
NCBI-GeneID: 369018
NCBI-ProteinID: NP_899163
RGD: 727955
UniProt: Q7TNA8
Position
1
AA seq 382 aa
MAWAVSILRARRRMGTVRVDFKDLGVALWPSQVLRVPPNRAWWSLTPTSTMATVKGKLLQ
HVSSEEPVLHNKVSIIGTGSVGMACAISIIAKGLTDELALVDSNEGKMKGETMDLQHGSV
FMKMPNIVCSKDFHVTANSEVVVITAGARQEKDETRLNLVQRNVSIFKIMFANIVKYSPR
CKIIIVSNPVDILTYVAWKLSGFPKNRVIGSGCNLDTARFRYMLGQRLGIHSESCHGWVL
GEHGDSSVPVWSGVNIAGVPLKELNSAIGTNKDPEQWGNVHKEVIASAYKIIKMKGYTSW
AIGLSVADIAESILKNLRKTHPVSTKIKGLYGIKEEVFLSVPCVLGENGISDIIKVKLSP
TEEAQMVKSADTIWKIQKDIKF
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcctgggctgtaagcatcctgagggccagaagaagaatgggtacagtcagggtagat
ttcaaggacttgggcgtagctttatggcccagtcaggtgctgcgtgtccctcccaaccgg
gcctggtggagcctcacccccacgtccaccatggcgactgtgaagggtaaacttctccag
cacgtcagctccgaagaacccgttctccacaacaaggtctccattataggaactggatcc
gtcggcatggcctgtgccatcagcatcatagcgaaaggcttgactgatgagcttgctctt
gttgatagtaatgaaggaaaaatgaagggtgagacaatggatctccagcacggcagtgtc
ttcatgaaaatgccaaatattgtttgcagcaaggatttccatgtcactgccaactctgag
gtagtggttatcacagcgggagcacgacaagagaaagatgagacgcgtctaaatttagtc
cagcgaaacgtatctatctttaagataatgtttgccaatattgtcaagtacagccctcgc
tgcaaaattatcattgtttccaacccagtggacatcctaacttacgtagcgtggaaattg
agtgggtttcccaaaaaccgtgttattggaagtggctgtaacctagatacagctcgtttc
cgttacatgcttgggcagaggcttgggatccactctgaaagctgtcatgggtgggtcctt
ggagagcatggagactcaagtgtccctgtgtggagtggtgtaaacatcgctggtgtgcct
ctgaaagagctgaattcagctataggaactaacaaagacccggagcagtggggcaatgtc
cacaaagaagtcattgccagtgcctataaaattatcaaaatgaaaggctatacttcctgg
gccattggcctgtctgtagctgatattgcagagagtattctgaagaatctcaggaaaacg
cacccagtttccaccaaaattaaaggtttatacggaataaaagaagaggtgttcctcagt
gtgccttgtgtcctgggagagaatggcatatctgatattataaaggtgaagctgagccct
acagaggaggcccagatggtaaagagcgcagacactatttggaaaatccagaaagatatc
aagttttaa

DBGET integrated database retrieval system