KEGG   Rattus norvegicus (rat): 24536Help
Entry
24536             CDS       T01003                                 

Gene name
Lepr, Fa
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04080  Neuroactive ligand-receptor interaction
rno04152  AMPK signaling pathway
rno04630  Jak-STAT signaling pathway
rno04920  Adipocytokine signaling pathway
rno04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    24536 (Lepr)
   04152 AMPK signaling pathway
    24536 (Lepr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24536 (Lepr)
   04060 Cytokine-cytokine receptor interaction
    24536 (Lepr)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    24536 (Lepr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24536 (Lepr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    24536 (Lepr)
   04090 CD molecules [BR:rno04090]
    24536 (Lepr)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  Prolactin receptor family
   24536 (Lepr)
CD molecules [BR:rno04090]
 Proteins
  24536 (Lepr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3 SRTM1
Motif
Other DBs
NCBI-GeneID: 24536
NCBI-ProteinID: NP_036728
RGD: 3001
Ensembl: ENSRNOG00000023664
UniProt: Q62959
Position
5q33
AA seq 1162 aa AA seqDB search
MTCQKFYVVLLHWEFLYVITALNLAYPTSPWRFKLFCAPPSTTDDSFLSPAGVPNNTSSL
KGASEALVEAKFNSTGIYVSELSKTIFHCCFGNEQGQNCSALTGNTEGKTLASVVKPLVF
RQLGVNWDIECWMKGDLTLFICHMEPLLKNPFKNYDSKVHLLYDLPEVIDDLPLPPLKDS
FQTVQCNCSVRECECHVPVPRAKVNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPL
GLRMEVTDDGNLKISWDSQTKAPFPLQYQVKYLENSTIVREAAEIVSDTSLLVDSVLPGS
SYEVQVRSKRLDGSGVWSDWSLPQLFTTQDVMYFPPKILTSVGSNASFCCIYKNENQTIS
SKQIVWWMNLAEKIPETQYNTVSDHISKVTFSNLKATRPRGKFTYDAVYCCNEQACHHRY
AELYVIDVNINISCETDGYLTKMTCRWSPSTIQSLVGSTVQLRYHRRSLYCPDNPSIRPT
SELKNCVLQTDGFYECVFQPIFLLSGYTMWIRINHSLGSLDSPPTCVLPDSVVKPLPPSN
VKAEITINTGLLKVSWEKPVFPENNLQFQIRYGLNGKEIQWKTHEVFDAKSKSASLPVSD
LCAVYVVQVRCRRLDGLGYWSNWSSPAYTLVMDVKVPMRGPEFWRIMDGDITKKERNVTL
LWKPLMKNDSLCSVRRYVVKHRTAHNGTWSQDVGNQTNLTFLWAESAHTVTVLAINSIGA
SLVNFNLTFSWPMSKVNAVQSLSAYPLSSSCVILSWTLSPNDYSLLYLVIEWKNLNDDDG
MKWLRIPSNVNKYYIHDNFIPIEKYQFSLYPVFMEGVGKPKIINGFTKDDIAKQQNDAGL
YVIVPIIISSCVLLLGTLLISHQRMKKLFWDDVPNPKNCSWAQGLNFQKPETFEHLFTKH
AESVIFGPLLLEPEPVSEEISVDTAWKNKDEMVPAAMVSLLLTTPDSTRGSICISDQCNS
ANFSGAQSTQGTCEDECQSQPSVKYATLVSNVKTVETDEEQGAIHSSVSQCIARKHSPLR
QSFSSNSWEIEAQAFFLLSDHPPNVISPQLSFSGLDELLELEGNFPEENHGEKSVYYLGV
SSGNKRENDMLLTDEAGVLCPFPAHCLFSDIRILQESCSHFVENNLNLGTSGKNFVPYMP
QFQSCSTHSHKIIENKMCDLTV
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgtcagaaattctatgtggttttgttacactgggaatttctgtatgtgataact
gcacttaacctggcctatccaacctctccctggagatttaagctgttttgtgcgccaccg
agtacaactgatgactcctttctctctcctgctggagtcccaaacaatacttcgtctttg
aagggggcttctgaagcacttgttgaagctaaatttaattcaactggtatctacgtttct
gagttatccaaaaccattttccactgttgctttgggaatgagcaaggtcaaaactgctcc
gcactcacaggcaacactgaagggaagacgctggcttcagtggtgaagcctttagttttc
cgccaactaggtgtaaactgggacatagagtgctggatgaaaggggacttgacattattc
atctgtcatatggaaccattacttaagaaccccttcaagaattatgactctaaggttcac
cttttatatgatctgcctgaagttatagatgatttgcctctgcccccactgaaagacagc
tttcagactgtccagtgcaactgcagtgttcgggaatgcgaatgtcatgtaccagtaccc
agagccaaagtcaactacgctcttctgatgtatttagaaatcacatctgctggtgtgagt
tttcagtcacctctaatgtcactgcagcccatgcttgttgtgaagcccgatccaccgctg
ggtttgcgtatggaagtcacagatgatggtaatttaaagatttcatgggacagccaaaca
aaagcaccatttccacttcaatatcaggtgaaatatttagagaattctacaatcgtaaga
gaggctgctgaaatcgtctcggatacatctctgctggtagacagcgtgcttcctgggtct
tcatacgaggtccaggtgaggagcaagagactggatggctcaggagtctggagtgactgg
agtttacctcaactctttaccacacaagatgtcatgtattttccacccaaaattctgacg
agtgttggatccaatgcttccttttgctgcatctacaaaaatgagaaccagactatctcc
tcaaaacaaatagtttggtggatgaatctagccgagaagatccccgagacacagtacaac
actgtgagtgaccacattagcaaagtcactttctccaacctgaaagccaccagacctcga
gggaagtttacctatgatgcagtgtactgctgcaatgagcaggcatgccatcaccgctac
gctgaattatatgtgatcgatgtcaatatcaatatatcatgtgaaactgacgggtactta
actaaaatgacttgcagatggtcacccagcacaatccaatcactagtgggaagcactgtg
cagttgaggtatcacaggcgcagcctgtactgtcccgataatccatctattcgtcctaca
tcagagctcaaaaactgcgtcttacagacagatggcttttatgaatgtgttttccagcca
atctttctattatctggctatacaatgtggatcaggatcaaccattctttaggttcactt
gactctccaccaacgtgtgtccttcctgactccgtagtaaaaccactacctccatctaat
gtaaaagcagagattactataaacactggattattgaaagtatcttgggaaaagccagtc
tttccagagaataaccttcagttccagattcgatatggcttaaatggaaaagaaatacaa
tggaagacacacgaggtattcgatgcaaaatcaaaatcggccagcctgccagtgtcagat
ctctgtgcggtctatgtggtacaggttcgctgccggcggttggatggactagggtattgg
agtaattggagcagtccagcctacactcttgtcatggatgtaaaagttcctatgagaggg
cctgaattctggagaataatggatggggatattactaaaaaggagagaaatgtcaccttg
ctttggaagccactgatgaaaaatgactcactgtgtagtgtgaggaggtatgtggtgaag
catcgtactgcccacaatgggacatggtcacaagatgtgggaaatcagaccaatctcact
ttcctgtgggcagaatcagcacacactgttacagttctggccatcaattccatcggtgcc
tcccttgtgaattttaaccttacgttctcatggcccatgagtaaagtgaatgctgtgcag
tcactcagtgcttatcccctgagcagcagctgcgtcatcctttcctggacactgtcacct
aatgattatagtctgttatatctggttattgaatggaagaaccttaatgatgatgatgga
atgaagtggcttagaatcccttcgaatgttaacaagtattatatccatgataattttatt
cctatcgagaaatatcagtttagtctttacccagtatttatggaaggagttggaaaacca
aagataattaatggtttcaccaaagatgatatcgccaaacagcaaaatgatgcagggctg
tatgtcattgtaccgataattatttcctcttgtgtcctgctgctcggaacactgttaatt
tcacaccagagaatgaaaaagttgttttgggacgatgttccaaaccccaagaattgttcc
tgggcacaaggacttaatttccaaaagcctgaaacatttgagcatctttttaccaagcat
gcagaatcagtgatatttggtcctcttcttctggagcctgaaccagtttcagaagaaatc
agtgtcgatacagcttggaaaaataaagatgagatggtaccagcagctatggtctcactt
cttttgaccactccagattccacaaggggttctatttgtatcagtgaccagtgtaacagt
gctaacttctctggggctcagagcacccagggaacctgtgaggatgagtgtcagagtcaa
ccctcagttaaatatgcaacgctggtcagcaacgtgaaaacagtggaaactgatgaagag
caaggggctatacatagttctgtcagccagtgcatcgccaggaaacattccccactgaga
cagtctttttctagcaactcctgggagatagaggcccaggcatttttccttttatcagat
catccacccaatgtgatttcaccacaactttcattctcagggttggatgagcttttggaa
ctggagggaaattttcctgaagaaaatcacggggaaaaatctgtgtattatctaggagtc
tcctcaggaaacaaaagagagaatgatatgcttttgactgatgaggcaggggtattgtgc
ccattcccagctcactgtctgttcagtgacatcagaatcctccaggagagttgttcacac
tttgtagaaaataatttgaatttagggacctctggtaagaactttgtaccttacatgccc
cagtttcaatcctgttccactcacagtcataagataatagaaaataagatgtgtgactta
actgtgtaa

DBGET integrated database retrieval system