KEGG   Rattus norvegicus (rat): 24548
Entry
24548             CDS       T01003                                 

Gene name
Mbl1
Definition
(RefSeq) mannose-binding protein A precursor
  KO
K03991  mannose-binding lectin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    24548 (Mbl1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24548 (Mbl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24548 (Mbl1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    24548 (Mbl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24548 (Mbl1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    24548 (Mbl1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    24548 (Mbl1)
Lectins [BR:rno04091]
 C-Type lectins
  Group 3: Collectins
   24548 (Mbl1)
SSDB
Motif
Pfam: Lectin_C Collagen PKcGMP_CC
Other DBs
NCBI-GeneID: 24548
NCBI-ProteinID: NP_036731
RGD: 3055
Ensembl: ENSRNOG00000011706
UniProt: P19999
Structure
PDB: 

Position
16
AA seq 238 aa
MLLLPLLVLLCVVSVSSSGSQTCEETLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGP
PGKLGPPGSVGAPGSQGPKGQKGDRGDSRAIEVKLANMEAEINTLKSKLELTNKLHAFSM
GKKSGKKFFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAKTSAFLGITDEV
TEGQFMYVTGGRLTYSNWKKDEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCEFPA
NT seq 717 nt   +upstreamnt  +downstreamnt
atgctcctgcttccactgctcgtccttctctgtgtagtgagcgtgtcctcatcagggtca
caaacctgtgaggaaaccctgaagacttgctctgtgatagcctgcggcagagacgggaga
gatgggcccaaaggggagaagggagaaccaggtcaagggctcaggggcttgcagggccct
ccagggaaactggggcctccaggaagtgtaggagcccctggaagtcaaggaccaaaaggc
caaaaaggggatcgtggagacagcagagccattgaggtgaagctggcaaatatggaggca
gagataaacaccctgaagtcaaaactggagctaaccaacaagttgcatgccttctccatg
ggtaaaaagtctgggaagaagttctttgtgaccaaccatgaaaggatgcccttttccaaa
gtcaaggccctgtgctcagagctccgaggcactgtggctatccccaggaatgctgaggag
aacaaggccatccaagaagtggctaaaacctctgccttcctaggcatcacggacgaggtg
actgaaggccaattcatgtatgtgacaggggggaggctcacctacagcaactggaaaaag
gatgagcccaatgaccatggctctggggaagactgtgtcactatagtagacaacggtctg
tggaatgacatctcctgccaagcttcccacacggctgtctgcgagttcccagcctga

KEGG   Rattus norvegicus (rat): 64668
Entry
64668             CDS       T01003                                 

Gene name
Mbl2
Definition
(RefSeq) mannose-binding protein C precursor
  KO
K03991  mannose-binding lectin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    64668 (Mbl2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    64668 (Mbl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    64668 (Mbl2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    64668 (Mbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64668 (Mbl2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    64668 (Mbl2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    64668 (Mbl2)
Lectins [BR:rno04091]
 C-Type lectins
  Group 3: Collectins
   64668 (Mbl2)
SSDB
Motif
Pfam: Lectin_C Collagen Helo_like_N
Other DBs
NCBI-GeneID: 64668
NCBI-ProteinID: NP_073195
RGD: 67380
UniProt: P08661
Structure
PDB: 

Position
1
AA seq 244 aa
MSLFTSFLLLCVLTAVYAETLTEGAQSSCPVIACSSPGLNGFPGKDGHDGAKGEKGEPGQ
GLRGLQGPPGKVGPAGPPGNPGSKGATGPKGDRGESVEFDTTNIDLEIAALRSELRAMRK
WVLLSMSENVGKKYFMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQNVAKDVAFL
GITDQRTENVFEDLTGNRVRYTNWNEGEPNNVGSGENCVVLLTNGKWNDVPCSDSFLVVC
EFSD
NT seq 735 nt   +upstreamnt  +downstreamnt
atgtccctgttcacatccttccttctgctctgcgtgctcacggcagtctatgccgagacc
ttaaccgaaggggctcaaagtagctgccctgtgattgcctgcagttctccgggcctgaac
ggcttcccaggcaaagatggacacgacggtgccaagggagaaaagggagaaccgggtcaa
ggcctcagaggcttgcagggccctcctggaaaagtaggacctgcagggcccccagggaat
cctgggtcaaaaggagcaacgggaccaaaaggagaccgtggagagagtgtagaatttgat
actaccaacattgatttagaaattgcagccctgcgatcggagctgagagctatgagaaag
tgggtgctcctttctatgagtgaaaatgttggaaagaagtacttcatgagcagtgttaga
aggatgccccttaacagagcgaaggctctgtgctccgaactccagggcactgtggccact
cccaggaatgctgaggaaaatagggccatccagaatgtggccaaagatgttgccttcttg
ggcataacggaccagaggactgaaaacgtttttgaggacctgacaggaaacagagtgcgc
tacactaactggaatgagggtgagcccaacaatgtgggctctggggaaaactgtgtggtg
ctcttgacaaatgggaagtggaatgacgttccttgctctgattcttttttggtagtttgt
gaattctctgactga

DBGET integrated database retrieval system