KEGG   Rattus norvegicus (rat): 24551Help
Entry
24551             CDS       T01003                                 

Gene name
Mdh1, MDL1, Mdhl, Mor2
Definition
(RefSeq) malate dehydrogenase 1
  KO
K00025  malate dehydrogenase [EC:1.1.1.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00270  Cysteine and methionine metabolism
rno00620  Pyruvate metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04964  Proximal tubule bicarbonate reclamation
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    24551 (Mdh1)
   00620 Pyruvate metabolism
    24551 (Mdh1)
   00630 Glyoxylate and dicarboxylate metabolism
    24551 (Mdh1)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    24551 (Mdh1)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    24551 (Mdh1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     24551 (Mdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N DUF4809 Glyco_hydro_3_C Oxidored_q6
Motif
Other DBs
NCBI-GeneID: 24551
NCBI-ProteinID: NP_150238
RGD: 3072
Ensembl: ENSRNOG00000008103
UniProt: O88989
Position
14q22
AA seq 334 aa AA seqDB search
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKN
VIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKL
SSAMSAAKAISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKETAFEFLSSA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagccaatcagagtcctcgtgacaggagcagccggtcagattgcatattcgctg
ctgtacagcattggaaatggatctgtctttgggaaagaccagcccatcattcttgtgctg
ttggacatcacccccatgatgggtgttctggacggtgtcctgatggagctgcaagactgt
gcccttccccttctgcaggatgtcattgcaacagacaaagaagaggttgccttcaaagac
ctggacgtggctgtccttgtgggctccatgccaagaagggagggcatggagaggaaggac
ctactgaaagccaacgtgaagatcttcaaatcccagggcgcagccttggagaagtacgcc
aagaaatcagttaaggtcattgttgtggggaacccagccaatacaaactgcctgacggcc
tccaagtcagcaccatcgatccccaaggagaacttcagttgcctgactcgattggaccac
aaccgagcaaaatctcaaattgctcttaaactcggtgtaaccgctgatgatgtaaaaaat
gtcattatctggggaaatcattcatcaacccagtatccagatgtcaatcatgccaaggtg
aaattgcaaggaaaagaagttggtgtgtatgaagccctcaaagacgacagctggctcaag
ggagagttcatcacgactgtgcagcagcgtggtgctgctgtcatcaaggctcggaagctg
tccagtgccatgtctgctgcgaaggccatctcggaccacatcagagacatctggtttgga
accccggagggcgagttcgtgtcgatgggcgtaatctctgatggcaactcctatggtgtc
cctgatgacctgctctactcgttccctgtcgtgatcaagaataagacctggaagtttgtt
gaaggcctccccattaacgacttctcccgtgagaagatggacctgacagcaaaggagctg
accgaggaaaaggaaacggcttttgagtttctctcctccgcatga

DBGET integrated database retrieval system