KEGG   Rattus norvegicus (rat): 24553
Entry
24553             CDS       T01003                                 

Gene name
Met
Definition
(RefSeq) hepatocyte growth factor receptor precursor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04520  Adherens junction
rno05100  Bacterial invasion of epithelial cells
rno05144  Malaria
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
rno05218  Melanoma
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24553 (Met)
   04014 Ras signaling pathway
    24553 (Met)
   04015 Rap1 signaling pathway
    24553 (Met)
   04020 Calcium signaling pathway
    24553 (Met)
   04151 PI3K-Akt signaling pathway
    24553 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24553 (Met)
   04520 Adherens junction
    24553 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    24553 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24553 (Met)
   05202 Transcriptional misregulation in cancer
    24553 (Met)
   05206 MicroRNAs in cancer
    24553 (Met)
   05205 Proteoglycans in cancer
    24553 (Met)
   05230 Central carbon metabolism in cancer
    24553 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    24553 (Met)
   05226 Gastric cancer
    24553 (Met)
   05218 Melanoma
    24553 (Met)
   05211 Renal cell carcinoma
    24553 (Met)
   05223 Non-small cell lung cancer
    24553 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    24553 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    24553 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24553 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24553 (Met)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24553 (Met)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  MET family
   24553 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema TIG Pkinase PSI Kinase-like Pkinase_fungal PepSY_TM
Other DBs
NCBI-GeneID: 24553
NCBI-ProteinID: NP_113705
RGD: 3082
Ensembl: ENSRNOG00000052745
UniProt: P97523
Position
4
AA seq 1382 aa
MKAPTALAPGILLLLLTLAQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGH
HIYLGATNYIYVLNDKDLQKVSEFKTGPVVEHPDCFPCQDCSSKANVSGGVWKDNVNMAL
LVDTYYDDQLISCGSVNRGTCQRHVLPPDNAADIQSEVHCMFSPLAEEESGQCPDCVVSA
LGAKVLLSEKDRFINFFVGNTINSSYPPDYSLHSISVRRLKETQDGFKFLTDQSYIDVLG
EFRDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPYDDILYGVFAQSKPDSAEPMNR
SAVCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQAVDLFMGRLNHVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHFTPHVNF
LLDSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCG
WCHNRCVHSNECPSGTWTQEICLPAVYKVFPTSAPLEGGTMLTICGWDFGFKKNNKFDLR
KTKVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIVSNSRETTQYSAFSYVDPVI
TSISPRYGPHAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPGHTVSAE
FPVKLKIDLADRVTSSFSYGEDPFVSEIHPTKSFISGGSTITGIGKNLNSVSTPKLVIEV
HDVGVNYTVACQHRSSSEIICCTTPSLQQLDLQLPLKTKAFFLLDGILSKHFDLTYVHDP
MFKPFEKPVMISMGNENVVEIKGDDIDPEAVKGEVLKVGNKSCENLHWHSEALLCTVPSD
LLKLNGGELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLVSGLFLWLRKR
KHKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
ACRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDSDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKC
WHPKAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEA
NT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggctcccaccgcgctggcacctggcattctgctgctgctgctgaccttggcgcag
aggagccatggggagtgcaaggaggccctagtgaagtctgagatgaacgtgaacatgaag
taccagcttcccaacttcaccgcagaaacccccatccagaatgtcgtcctccatgggcac
catatttatctcggagccacaaactacatttatgttttaaatgacaaagaccttcagaag
gtatctgagttcaagaccgggcccgtggtggaacacccagattgttttccttgtcaggac
tgcagcagcaaagccaatgtgtcaggaggtgtttggaaagacaacgtcaacatggcgctg
cttgttgacacttactatgacgaccagctcatcagctgtggcagcgtcaacagagggacc
tgccaaaggcatgtccttcctcctgacaatgctgccgacattcagtccgaggttcactgc
atgttctccccacttgcggaggaagagtcaggccagtgtcccgactgtgtagtgagtgcc
ctgggagccaaagtcctcctgtctgaaaaggaccggttcatcaatttcttcgtggggaat
acgataaactcttcctaccctcccgattattcattgcattcaatatcggtgaggcggctg
aaggaaacccaggacggttttaagtttttgacagaccagtcctacattgatgtcctggga
gaattccgagattcctaccccatcaagtacatacatgccttcgaaagcaaccattttatc
tactttctgactgtccagaaggaaaccctagatgctcagactttccatacaagaataatc
aggttctgttctgtagactctgggttgcactcctacatggaaatgcctctggagtgcatt
ctgacggaaaaaagaagaaagagatccacaagggaagaagtgtttaatatcctccaagcc
gcgtatgtcagtaaaccaggggccaatcttgctaagcaaataggggccagcccgtatgat
gacattctctacggggtgtttgcacaaagcaagccagattctgctgagcccatgaaccga
tcagcggtctgtgcattccccatcaaatatgtcaatgacttcttcaacaagattgtcaac
aaaaacaacgtacggtgtctccagcatttttatggacccaaccacgagcactgtttcaat
aggaccctgctgagaaattcatcgggctgcgaagtgcgcagtgacgagtaccggacggag
tttaccacagcgctgcaggctgtggatttattcatgggccggctcaaccatgtactcttg
acgtctatctctaccttcatcaaaggtgacctcaccattgctaatctagggacatcagaa
ggtcgcttcatgcaggtggtgctctctcgcacagcacatttcaccccccatgtgaatttc
ctcctggattcccatcctgtgtctccggaagttattgtcgaacatccatcaaatcaaaat
ggctataccctggtggtcacagggaagaagatcaccaagattccactgaatggcctaggc
tgtgggcatttccagtcctgcagtcagtgtctctctgccccctactttatacagtgtggc
tggtgccacaatcggtgtgtgcattccaatgaatgccccagcggtacatggactcaagag
atctgtctgccagcagtttataaggttttccccactagtgcacccctcgaaggaggaaca
atgctgaccatatgtggctgggactttggattcaagaagaataataaatttgatttaagg
aaaaccaaagttctgcttggcaacgagagctgtaccttgaccttaagcgagagcacgaca
aatacgttgaaatgcacagttggccccgcgatgagtgagcacttcaatgtgtctgtgatc
gtctcaaacagtcgagagacaacacagtacagtgcgttttcctatgtggatcctgtaata
acaagtatttctccaaggtatggtcctcatgccggaggcaccttactcactttgactgga
aaatacctcaacagcggcaattctagacacatttcaatcggagggaaaacatgtacttta
aaaagtgtatcagatagcattctcgaatgctacaccccaggccacaccgtctctgccgag
tttcccgtgaaattgaaaatcgacctggctgaccgagtgacaagcagcttcagttacggg
gaagacccgtttgtctctgaaatccacccgaccaaatcttttatcagtggtggaagcaca
ataacggggattggaaagaacctgaattcagttagcaccccaaagctggtaatagaagtg
catgacgtgggcgtgaactacaccgtggcgtgccaacatcgctcgagttcagagatcatc
tgctgcaccactccttccctgcaacagctggacctgcaactccccctgaagaccaaagcc
ttcttcctgctggacgggatcctttccaaacactttgatctcacttatgtacatgatcct
atgtttaagccttttgaaaagccagtaatgatctccatgggcaatgagaatgtagtggaa
attaagggagacgatattgaccctgaagcagttaaaggtgaagtgttaaaagtcgggaat
aagagctgtgagaatctccactggcattctgaagctttgttgtgtacggtccccagtgac
ctgctgaagctgaacggcggcgagctaaatatagagtggaagcaagcagtctcttcaact
gtccttggaaaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgcg
gtctcaatatcagtggtagttttgttagtatccgggctcttcctgtggctgagaaagaga
aagcataaagatctgggcagtgaattagttcgctatgacgcaagagtacacactcctcat
ttggataggcttgtaagtgcccgaagtgtaagcccaactacagagatggtctcaaatgag
tctgtagactacagagctacttttccagaagaccagtttcccaactcctctcagaatgga
gcctgcagacaagtgcagtatccactgacagatctgtcccccatcctgacgagtggagac
tctgatatatccagcccattactacaaaacactgttcacattgacctcagcgctctaaat
ccagagctggtccaagcggtgcagcacgtagtgattggacccagtagcctgattgtgcat
ttcaatgaagtcataggaagagggcattttggctgtgtctatcatgggactttgttggac
agtgacggaaagaaaattcactgtgctgtgaaatccttgaatagaatcacagatatagaa
gaagtctcccagtttctgactgagggaatcatcatgaaagatttcagccaccccaatgtt
ctctcactcttgggaatctgcctgcggagtgaagggtcccctctggtggttctgccctat
atgaagcacggagatcttcgcaatttcattcgaaacgagactcataacccaactgtgaaa
gatcttataggattcggtcttcaagtagccaagggcatgaaatatcttgccagcaaaaag
tttgtccacagagacttagctgcaagaaactgcatgttggatgaaaaattcactgtcaag
gttgctgatttcggtcttgccagagacatgtacgacaaagagtattatagcgtccacaac
aaaacgggtgcgaaactaccggtgaagtggatggctttagagagtctgcagacgcaaaag
ttcaccaccaagtcagacgtgtggtccttcggtgtgcttctctgggagctcatgacgaga
ggagcccctccttatcctgacgtgaacacatttgatatcactatatacctgttgcaaggc
agaagactcttgcaaccagagtactgtccagacgccttgtatgaagtgatgctaaaatgc
tggcaccccaaagcagaaatgcgcccatcgttttctgaactggtctccagaatatcctca
atcttctccactttcattggcgagcactatgtccatgtgaacgctacttatgtgaatgta
aaatgtgttgctccatatccttctctgttgccatcccaagacaacattgacggcgaagcg
aacacatga

DBGET integrated database retrieval system