KEGG   Rattus norvegicus (rat): 24558
Entry
24558             CDS       T01003                                 

Gene name
Mog
Definition
(RefSeq) myelin oligodendrocyte glycoprotein
  KO
K17270  myelin-oligodendrocyte glycoprotein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24558 (Mog)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   24558 (Mog)
SSDB
Motif
Pfam: V-set I-set Ig_3 ig Ig_6 Longin
Other DBs
NCBI-GeneID: 24558
NCBI-ProteinID: NP_073159
RGD: 3102
Ensembl: ENSRNOG00000000775
Vega: OTTRNOG00000001464
UniProt: Q6MFX9
Structure
PDB: 
1PKO 3CSP 1PKQ

Position
20p12
AA seq 245 aa
MAGVWSLSLPSCLLSLLLLLQLSCSYAGQFRVIGPGHPIRALVGDEAELPCRISPGKNAT
GMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKESIGEGKVALRIQNVRFSDE
GGYTCFFRDHSYQEEAAVELKVEDPFYWINPGVLALIALVPMLLLQVSVGLVFLFLQHRL
RGKLRAEVENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEE
LRNPF
NT seq 738 nt   +upstreamnt  +downstreamnt
atggccggtgtgtggagcctttctctgcccagctgcctcctgtccctgctcctcctcctc
cagttgtcatgcagctacgcaggacagttcagagtgatagggccagggcatcccatccgg
gctttagttggggatgaagcagaactgccgtgccgtatatctcctgggaagaatgccacg
ggcatggaggtggggtggtaccgttctcccttttcaagagtggttcatctgtaccgaaat
ggcaaggaccaagacgcagagcaagcgcctgaataccggggacgcacagagcttctgaaa
gagtctatcggcgagggaaaggttgccctcaggatccagaacgtgaggttctcggatgaa
ggaggctacacatgcttcttcagagaccactcctaccaagaagaagccgccgtggagttg
aaagtagaagatcccttctactggatcaaccctggcgtgctggctctcattgcccttgtg
cctatgctgctcctgcaggtctctgtaggccttgtattcctcttcctgcagcacagactg
agaggaaaactccgtgcagaagtcgagaatctccatcggacttttgatcctcacttcctg
agagtgccctgctggaagataacactgtttgttattgtccctgttcttggacccctggtt
gctttgatcatctgctacaactggctgcaccgaagactggcaggacagtttcttgaagag
ctaagaaaccccttttga

DBGET integrated database retrieval system