KEGG   Rattus norvegicus (rat): 24571Help
Entry
24571             CDS       T01003                                 

Gene name
Muc1
Definition
(RefSeq) mucin 1, cell surface associated
  KO
K06568  mucin-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24571 (Muc1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24571 (Muc1)
   04090 CD molecules [BR:rno04090]
    24571 (Muc1)
Membrane trafficking [BR:rno04131]
 Others
  Mucins
   Membrane bound mucins
    24571 (Muc1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   24571 (Muc1)
  Exosomal proteins of breast cancer cells
   24571 (Muc1)
  Exosomal proteins of bladder cancer cells
   24571 (Muc1)
CD molecules [BR:rno04090]
 Proteins
  24571 (Muc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SEA DUF4381 Stevor Shisa
Motif
Other DBs
NCBI-GeneID: 24571
NCBI-ProteinID: NP_036734
RGD: 3122
Ensembl: ENSRNOG00000020539
Vega: OTTRNOG00000000895
UniProt: B2GV31
Position
2q34
AA seq 655 aa AA seqDB search
MTPGIRVPLLLLLLLASLKVRSGASSSTTSLPGDSFSTAVPSGASSSATSPPVDSTTSPV
HSSTSFPATSPPGDSTSTAVLSGDSDPATSPPGDSSSTAVPNGASSSATSPPVDSTTSPV
HSSTSFPATSSPGDSTSTAVTSGTSSSATSPPEDSSSTAVTSGTSSPATSPPGDSSSTAV
TSGTSSPATSPILDSSSTAVLSGTSSPATSPPEDSTSTAVTSGTSSPATSPPEDSTSTAV
TSGTSSPATSPILDSSSTAIHSGTSSPATSPPGDSSSTAVLSGASTQTTKAVSDLASTPT
HNGIMVPTTWSALSSATSPVYSGSSATTNSSESDMATTPVYSGTPFSSTTATSAITPDHN
GSLVRTTSSVLGLATSPAHDTSAVATTPVRNDTQSSVPSQQPISPTIPAISSHSTVSSSS
YYSTAVFPTFSSNSSPQLSVGVSFFSLSFYIRNHPFNSSLEDPSSRYYQELKRNISGLFL
QVFNGDFLGVSTIKFRSGSVVVASTVIFREGTFSASEVKSQLVQHKKEAADYNLTISEVN
VNEMQFPSSAQSWPGVPGWGIALLVLVCILVALVIVYLIALALCQCRRKSYGQLDLFPTR
DTYHPMSEYPTYHTHGRYVPPATTKRSPYEEVSTGNGSSGLSYTNPAVATTSANL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgggcatacgggttcctctcctcctgctgctacttctagcaagcctaaaagtc
cgcagtggtgcctcctcctcaaccaccagccttccaggggactccttcagcactgcagtc
cccagtggtgcctcttcctcagccaccagccctccagtggactccaccacctctccagtt
catagtagcacctcgttcccagccaccagccctccaggagactccaccagcactgcagtc
ctcagtggtgactcagatccagccaccagccctccaggggactcctccagcactgcagtc
cccaatggtgcctcttcctcagccaccagccctccagtggactccaccacctccccagtt
catagtagcacctcgttcccagccaccagctctccaggggactccaccagcactgcagtc
accagtggcacctcttcctcagccaccagccctccagaggactcctccagcactgcagtc
accagtggcacctcgtccccagccaccagccctccaggggactcctccagcactgcagtc
accagtggcacctcgtccccagccaccagccctatattggactcctccagcactgcagtc
ctcagtggcacctcgtccccagccaccagccctccagaggactccaccagcactgcagtc
accagtggcacctcgtccccagccaccagccctccagaggactccaccagcactgcagtc
accagtggcacctcgtccccagccaccagccctatattggactcctccagcactgcaatc
cacagtggcacctcgtccccagccaccagccctccaggggactcctccagcactgcagtc
ctcagcggtgcttccacccaaaccaccaaggctgtatcagacttagctagcactccaacc
cacaatggcatcatggtcccaactacctggtctgcattgagctcagccaccagtccggtg
tacagtggttcctcagctacaactaatagctctgaatcagacatggccaccactccagtg
tacagtggcaccccattctcttctaccacggctacgtcagctatcaccccagaccacaat
ggctccttggtgcgaactaccagttctgtgttgggcttagccaccagtccagcccatgat
acctctgcggtggccacaactccagtccgcaatgacactcagtcttcagttccaagtcag
cagcccatctctcccaccatccccgccatctccagccacagtactgttagcagcagctct
tactacagcacagcggtcttccctaccttctccagtaacagctcaccccagttgtctgtc
ggggtctccttcttctcgttgtctttttacattcggaaccacccatttaattcttccctg
gaagaccccagctcccgctactaccaagaactgaagaggaacatttccggattgtttctg
caggtttttaacggagactttctgggggtctctactatcaagttcaggtcaggctcggtg
gtggtagcatcgactgtgattttccgggagggcactttcagtgcctctgaagtgaagtca
cagctcgtacaacataagaaggaggcagctgactataatctgactatctcggaagtcaat
gtgaatgagatgcagttcccttcctctgcccagtcttggcctggggtaccaggttggggc
attgccctgctggtactggtctgtattttggtggctttggtcatcgtctatctcattgcc
ctggcattgtgccagtgccgcagaaagagctatgggcagctggacctctttccaacccgg
gacacctaccatcctatgagtgaatatcctacctaccacactcacggacgctatgtgccc
cctgccactaccaaacgtagcccctatgaagaggtttcgacaggcaatggcagtagcggt
ctctcttacaccaacccggctgtggcaaccacttcggccaacttgtag

DBGET integrated database retrieval system