KEGG   Rattus norvegicus (rat): 24582Help
Entry
24582             CDS       T01003                                 

Gene name
Myh11
Definition
(RefSeq) myosin heavy chain 11
  KO
K10352  myosin heavy chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24582 (Myh11)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24582 (Myh11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24582 (Myh11)
   04147 Exosome [BR:rno04147]
    24582 (Myh11)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     24582 (Myh11)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   24582 (Myh11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N CC2-LZ IQ ADIP AAA_22
Motif
Other DBs
NCBI-GeneID: 24582
NCBI-ProteinID: NP_001164071
RGD: 3136
Ensembl: ENSRNOG00000057880
UniProt: E9PTU4
Position
10q11
AA seq 1972 aa AA seqDB search
MAQKGQLSDDEKFLFVDKNFINSPMAQADWVAKKLVWVPSEKQGFEAASIKEEKGDEVVV
ELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDSSITGELEKQLLQANPILEAFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYLIAGAKEKMRNDLL
LESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFSEEEQLAILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQADFA
IEALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLN
DNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQ
LGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEE
ERDLKITDVIMAFQAMCRGYLARKAFTKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK
VKPLLQVTRQEEEMQAKEEEMQKIKERQQKAESELKELEQRHTQLAEEKTLLQEQLQAET
ELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRSQQLQAERKKMAQQMLDLEEQLE
EEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNNKLSKERKLLEERVSDLTTNLAEEEE
KAKNLTKLKSKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDEEITQKNNALKKIRELEGHVSDLQEDLDSERAARNKAEKQ
KRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTMLKKALDEETRSHEAQVQEMRQK
HTQAVEELTEQLEQFKRAKANLDKSKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEGQ
LQELQSKCSDGERARTELSDKVHKLQNEVESVTGMLNEAEGKAIKLAKEVASLGSQLQDT
QELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEMEAKQNLERHVSTLNIQLSDSKKKL
QDLASTIEVMEEGKKRLQKEMEGLGQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKE
ELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMRTQLEELEDELQATED
AKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAVKGREEAIKQLRKLQAQMKDFQRELDDARASRDEIFATSKENEK
KAKSLEAELMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQ
LEEELEEEQGNMEAMSDRVRKATLQAEQLSNELVTERSAAQKNESARQQLERQNKELRSK
LQEVEGAVKAKLKSTVAALEAKIVQLEEQIEQEAREKQAATKLLKQKDKKLKEVLLQVED
ERKMVEQYKEQAEKGNTKVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGRE
VNALKSKLRRGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaaagggcagctcagtgatgatgagaagttcctctttgtggataaaaacttc
ataaacagcccaatggcccaggccgactgggtagccaagaagctagtatgggtcccttca
gagaagcagggcttcgaagcagccagcatcaaggaggagaagggcgatgaggtggttgta
gagctggtggaaaacggaaagaaggtcacagtgggcaaagatgacatccaaaaaatgaac
ccgcccaagttctccaaggtggaagacatggccgagctgacatgcctcaatgaggcttct
gtgctgcacaacctgagggagcggtacttctcaggcctcatctacacctactcgggcctc
ttctgtgtggtggtcaacccctacaagcacctacccatctactcagaaaagattgtggac
atgtacaagggcaagaagaggcatgagatgccgcctcacatctatgccattgctgatacg
gcctacagaagcatgctacaagatcgtgaagaccagtccattctgtgcacaggtgagtct
ggagctggaaagacagagaacacaaagaaagtcatacagtatttggctgtggtggcatcc
tcccacaaaggcaagaaagacagcagcatcacgggggagctggaaaagcagcttctacag
gcaaacccaatcctggaggctttcggcaatgcaaaaactgtcaagaatgacaactcctcc
cgctttggcaagttcattcgcatcaactttgatgtcactggttacattgtgggtgccaat
atcgaaacatatcttctggaaaagtctcgggctattcgacaggctagggacgagagaacg
ttccacatcttctactatctgatcgctggagccaaggagaagatgagaaatgacctactt
ttggagagcttcaacagctacacatttttatccaatggctttgtgcccatcccagctgca
caagatgatgagatgttccaggagacactagaggccatgtccatcatgggcttcagtgaa
gaggaacagctagccatcttgaaggtagtatcatccgtccttcagcttggaaacattgtc
ttcaagaaggagcgaaacacagaccaggcatccatgcctgataacacagctgctcagaaa
gtttgccaccttgtggggattaatgtgacagatttcaccagagccatcctgaccccacgt
ataaaagttggacgggatgtggtgcagaaagctcagaccaaagaacaggctgactttgcc
attgaggccttagccaaggccacctatgagcgccttttccgatggattctcagccgtgtg
aacaaagccttggataagacccatcgtcagggggcctccttcctgggcattctggatatt
gctgggtttgaaatctttgaggtaaactccttcgagcagctgtgcatcaactacaccaat
gagaagttgcagcagctgttcaatcacaccatgttcatcctggagcaggaagagtaccaa
cgagagggcatcgagtggaacttcatcgactttggcctggacctacagccttgtattgaa
ctgattgagcggccgaacaaccctcctggtgtgctggccctgctggatgaagaatgctgg
ttccccaaagctacggacaagtcttttgtggagaagctgtgctcagagcagggcaatcac
cccaaatttcagaagcccaagcagctaaaggacaaaacagagttctccatcatccactat
gctgggaaggtggactataatgcaagtgcgtggctgaccaagaacatggacccgctaaat
gataatgtgacctcactcctcaatgcctcctcggacaagtttgtggccgacctgtggaag
gatgtggaccgcattgtggggttggaccagatggccaagatgactgagagctcactgccc
agtgcctccaagaccaaaaagggcatgttccgcaccgtgggccagctctacaaagagcag
ctggggaagctgatgaccacactgcgcaacaccacgcctaactttgtgcgctgcatcatc
cccaaccatgaaaagaggtctggcaagctggatgcatttctagttctggagcagctgcgg
tgcaatggtgtgttggaaggcatccgcatctgccgtcagggcttccccaacaggattgtc
ttccaagagttccggcaacgctacgagatcctggcagcgaacgccatccccaaaggcttc
atggacggaaagcaagcctgcattctcatgatcaaagcccttgaacttgaccccaatctg
tacaggattgggcagagcaaaatcttctttcgtacgggagtcctggcccacctagaggaa
gaacgagacctgaagattactgatgtcatcatggctttccaggcaatgtgtcgtggctac
ctggccagaaaagccttcaccaagaggcagcaacagttaacagccatgaaggtgatccag
aggaactgcgctgcctaccttaagctccgcaactggcaatggtggaggctcttcactaaa
gtaaagccgctgctccaggtgacgcggcaggaggaggagatgcaggccaaggaggaggag
atgcagaagatcaaggagcggcagcagaaggcagagtctgagctgaaggagctggagcaa
agacacactcagctggctgaggagaagaccctgctgcaggagcagttgcaggcagagaca
gagctgtatgctgaggctgaagagatgcgggtccgcttggcagcgaagaagcaggagcta
gaggagatcctccatgagatggaggcccgcttggaggaggaggaggaccggagccaacaa
ctgcaggctgagaggaagaagatggctcagcagatgctggacctggaggagcaactggag
gaggaagaagctgccagacagaaactacagctagagaaggtcacagctgaggccaagatc
aagaaactggaggatgacatcttggttatggatgaccagaacaataagctttccaaagaa
agaaaactccttgaagagagggtcagcgacttgacaaccaacctagcagaagaggaagaa
aaggctaaaaacctcacaaaactaaagagcaagcatgagtccatgatctcagagctagag
gtgaggctgaagaaagaggagaagagccggcaggagctggagaaactcaagaggaaactg
gagggtgatgccagtgacttccacgagcagatcgctgacctgcaggcccagattgcagag
ctcaagatgcagctggcaaagaaagaggaagagctacaggcagctctagccaggctcgat
gaagagatcacccagaaaaacaatgccctaaagaagattcgagagctggagggccatgtc
tcagacctacaggaggacctggactcagagcgagctgctaggaacaaggctgagaaacag
aagcgagacctgggggaggaactggaggcgctcaagacagagctggaagatacactggac
agcacagctacccagcaggagctcagagccaagagggaacaggaagtgacaatgctgaag
aaggccctggatgaagagacgcgatcccatgaggcccaggtccaggagatgaggcagaag
cacacacaggcagtggaggaactcacagagcagctggaacagttcaaaagggccaaggca
aacctggataaaagcaagcagacgctggagaaggagaacgcagacctggctggggagctg
cgtgtcctgggccaggcaaagcaggaggtagagcacaagaagaagaagctggaggggcag
ctgcaggagctgcagtccaagtgcagtgatggggagcgtgcccggactgagctcagtgac
aaggtccacaaactacagaatgaagtggagagtgtcacaggcatgctcaatgaggcagaa
ggcaaggccattaaactggccaaggaagtggcttcccttggatctcaacttcaggacacc
caagagctgcttcaagaagaaacccggcagaagctcaatgtgtccaccaagctgcgccag
ttggaagatgagaggaacagcctgcaggaccagctggatgaggagatggaagctaagcaa
aaccttgagcgccatgtctccaccttgaacattcagctctcagactctaagaagaagctg
caggaccttgcaagcactattgaggtcatggaggaggggaagaagaggttgcagaaagag
atggagggtctcggccagcagtatgaggagaaggccgctgcctatgacaaactggagaaa
actaagaacaggcttcagcaggagctagatgacttggtcgtggacttggacaaccagcgg
caactggtatccaatctggaaaagaagcagaagaaattcgatcagttgttagctgaggaa
aagaacatctcctccaagtatgcggatgagagagaccgagctgaagcagaggccagggaa
aaggaaacgaaggctttgtctctggcccgggccctggaggaagccctggaagccaaagag
gaactggaaaggaccaacaagatgctcaaggccgagatggaagacctggtcagctccaag
gatgacgtgggcaagaatgtgcacgagctggagaagtccaaacgagccctggagacccag
atggaagagatgagaactcagctagaggagctggaggacgagctgcaggccactgaagac
gccaagctgcggctggaggtcaacatgcaggccctcaagggccagtttgaacgagatctc
caggctcgggatgagcagaatgaggagaagaggaggcagctacagcggcagctgcatgag
tatgagacagaactggaagatgaacggaagcaaagggctctggcggcagcagccaagaag
aagctggaaggggatctgaaagacctggaactccaggctgactcagccgtcaaagggagg
gaggaagccatcaagcagcttcgaaaactgcaggctcagatgaaggacttccaaagagag
ctggatgatgcccgtgcctccagagatgagatctttgccacctcaaaagagaatgagaag
aaagccaagagtctggaggcagagctcatgcagctccaggaggacctggcagcagctgag
agagctcgcaagcaagctgacctggagaaggaggagctggctgaggagctggctagcagc
ttatcaggaaggaatacactgcaggatgagaagcgccgcctggaggcaaggatcgcccag
ctggaggaggagctggaggaagagcagggcaacatggaggccatgagtgacagagtccgc
aaggccacattgcaggctgagcaactgagcaatgagctggtcactgagcgcagtgcagct
cagaagaatgagagtgcacggcaacagctggagcgccagaacaaggaactccgaagcaag
ttgcaggaggtagaaggtgctgtcaaagccaagcttaagtccactgttgcggcactagag
gccaagattgtgcagctggaggagcagattgaacaagaggccagagaaaaacaggcagcc
accaagttgctgaagcaaaaggacaagaagctaaaggaggtcctactgcaggtggaggat
gagcgcaagatggtggagcagtacaaggagcaggcagagaaaggaaacaccaaggtcaag
cagctcaagaggcagctggaagaggccgaggaggaatcccagcgcatcaatgccaaccgc
aggaagctgcagcgggagctggatgaggccactgagagcaatgaggccatgggccgtgag
gtgaatgccctcaagagcaaactcaggagaggaaacgaggcttcatttgttccttccaga
agggctggaggccgtagagttattgaaaacacagatggttctgaagaagaaatggatgct
cgggactcagacttcaatggaaccaaagccagtgaataa

DBGET integrated database retrieval system