KEGG   Rattus norvegicus (rat): 24582
Entry
24582             CDS       T01003                                 

Gene name
Myh11
Definition
(RefSeq) myosin-11
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    24582 (Myh11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24582 (Myh11)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24582 (Myh11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24582 (Myh11)
   04147 Exosome [BR:rno04147]
    24582 (Myh11)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     24582 (Myh11)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   24582 (Myh11)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin CC2-LZ IQ ADIP ATG16 AAA_22
Other DBs
NCBI-GeneID: 24582
NCBI-ProteinID: NP_001164071
RGD: 3136
Ensembl: ENSRNOG00000057880
UniProt: E9PTU4
Position
10
AA seq 1972 aa
MAQKGQLSDDEKFLFVDKNFINSPMAQADWVAKKLVWVPSEKQGFEAASIKEEKGDEVVV
ELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDSSITGELEKQLLQANPILEAFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYLIAGAKEKMRNDLL
LESFNSYTFLSNGFVPIPAAQDDEMFQETLEAMSIMGFSEEEQLAILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLVGINVTDFTRAILTPRIKVGRDVVQKAQTKEQADFA
IEALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLN
DNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQ
LGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEE
ERDLKITDVIMAFQAMCRGYLARKAFTKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTK
VKPLLQVTRQEEEMQAKEEEMQKIKERQQKAESELKELEQRHTQLAEEKTLLQEQLQAET
ELYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRSQQLQAERKKMAQQMLDLEEQLE
EEEAARQKLQLEKVTAEAKIKKLEDDILVMDDQNNKLSKERKLLEERVSDLTTNLAEEEE
KAKNLTKLKSKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDEEITQKNNALKKIRELEGHVSDLQEDLDSERAARNKAEKQ
KRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTMLKKALDEETRSHEAQVQEMRQK
HTQAVEELTEQLEQFKRAKANLDKSKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEGQ
LQELQSKCSDGERARTELSDKVHKLQNEVESVTGMLNEAEGKAIKLAKEVASLGSQLQDT
QELLQEETRQKLNVSTKLRQLEDERNSLQDQLDEEMEAKQNLERHVSTLNIQLSDSKKKL
QDLASTIEVMEEGKKRLQKEMEGLGQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQKKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKE
ELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMRTQLEELEDELQATED
AKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAVKGREEAIKQLRKLQAQMKDFQRELDDARASRDEIFATSKENEK
KAKSLEAELMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNTLQDEKRRLEARIAQ
LEEELEEEQGNMEAMSDRVRKATLQAEQLSNELVTERSAAQKNESARQQLERQNKELRSK
LQEVEGAVKAKLKSTVAALEAKIVQLEEQIEQEAREKQAATKLLKQKDKKLKEVLLQVED
ERKMVEQYKEQAEKGNTKVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGRE
VNALKSKLRRGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE
NT seq 5919 nt   +upstreamnt  +downstreamnt
atggcacagaaagggcagctcagtgatgatgagaagttcctctttgtggataaaaacttc
ataaacagcccaatggcccaggccgactgggtagccaagaagctagtatgggtcccttca
gagaagcagggcttcgaagcagccagcatcaaggaggagaagggcgatgaggtggttgta
gagctggtggaaaacggaaagaaggtcacagtgggcaaagatgacatccaaaaaatgaac
ccgcccaagttctccaaggtggaagacatggccgagctgacatgcctcaatgaggcttct
gtgctgcacaacctgagggagcggtacttctcaggcctcatctacacctactcgggcctc
ttctgtgtggtggtcaacccctacaagcacctacccatctactcagaaaagattgtggac
atgtacaagggcaagaagaggcatgagatgccgcctcacatctatgccattgctgatacg
gcctacagaagcatgctacaagatcgtgaagaccagtccattctgtgcacaggtgagtct
ggagctggaaagacagagaacacaaagaaagtcatacagtatttggctgtggtggcatcc
tcccacaaaggcaagaaagacagcagcatcacgggggagctggaaaagcagcttctacag
gcaaacccaatcctggaggctttcggcaatgcaaaaactgtcaagaatgacaactcctcc
cgctttggcaagttcattcgcatcaactttgatgtcactggttacattgtgggtgccaat
atcgaaacatatcttctggaaaagtctcgggctattcgacaggctagggacgagagaacg
ttccacatcttctactatctgatcgctggagccaaggagaagatgagaaatgacctactt
ttggagagcttcaacagctacacatttttatccaatggctttgtgcccatcccagctgca
caagatgatgagatgttccaggagacactagaggccatgtccatcatgggcttcagtgaa
gaggaacagctagccatcttgaaggtagtatcatccgtccttcagcttggaaacattgtc
ttcaagaaggagcgaaacacagaccaggcatccatgcctgataacacagctgctcagaaa
gtttgccaccttgtggggattaatgtgacagatttcaccagagccatcctgaccccacgt
ataaaagttggacgggatgtggtgcagaaagctcagaccaaagaacaggctgactttgcc
attgaggccttagccaaggccacctatgagcgccttttccgatggattctcagccgtgtg
aacaaagccttggataagacccatcgtcagggggcctccttcctgggcattctggatatt
gctgggtttgaaatctttgaggtaaactccttcgagcagctgtgcatcaactacaccaat
gagaagttgcagcagctgttcaatcacaccatgttcatcctggagcaggaagagtaccaa
cgagagggcatcgagtggaacttcatcgactttggcctggacctacagccttgtattgaa
ctgattgagcggccgaacaaccctcctggtgtgctggccctgctggatgaagaatgctgg
ttccccaaagctacggacaagtcttttgtggagaagctgtgctcagagcagggcaatcac
cccaaatttcagaagcccaagcagctaaaggacaaaacagagttctccatcatccactat
gctgggaaggtggactataatgcaagtgcgtggctgaccaagaacatggacccgctaaat
gataatgtgacctcactcctcaatgcctcctcggacaagtttgtggccgacctgtggaag
gatgtggaccgcattgtggggttggaccagatggccaagatgactgagagctcactgccc
agtgcctccaagaccaaaaagggcatgttccgcaccgtgggccagctctacaaagagcag
ctggggaagctgatgaccacactgcgcaacaccacgcctaactttgtgcgctgcatcatc
cccaaccatgaaaagaggtctggcaagctggatgcatttctagttctggagcagctgcgg
tgcaatggtgtgttggaaggcatccgcatctgccgtcagggcttccccaacaggattgtc
ttccaagagttccggcaacgctacgagatcctggcagcgaacgccatccccaaaggcttc
atggacggaaagcaagcctgcattctcatgatcaaagcccttgaacttgaccccaatctg
tacaggattgggcagagcaaaatcttctttcgtacgggagtcctggcccacctagaggaa
gaacgagacctgaagattactgatgtcatcatggctttccaggcaatgtgtcgtggctac
ctggccagaaaagccttcaccaagaggcagcaacagttaacagccatgaaggtgatccag
aggaactgcgctgcctaccttaagctccgcaactggcaatggtggaggctcttcactaaa
gtaaagccgctgctccaggtgacgcggcaggaggaggagatgcaggccaaggaggaggag
atgcagaagatcaaggagcggcagcagaaggcagagtctgagctgaaggagctggagcaa
agacacactcagctggctgaggagaagaccctgctgcaggagcagttgcaggcagagaca
gagctgtatgctgaggctgaagagatgcgggtccgcttggcagcgaagaagcaggagcta
gaggagatcctccatgagatggaggcccgcttggaggaggaggaggaccggagccaacaa
ctgcaggctgagaggaagaagatggctcagcagatgctggacctggaggagcaactggag
gaggaagaagctgccagacagaaactacagctagagaaggtcacagctgaggccaagatc
aagaaactggaggatgacatcttggttatggatgaccagaacaataagctttccaaagaa
agaaaactccttgaagagagggtcagcgacttgacaaccaacctagcagaagaggaagaa
aaggctaaaaacctcacaaaactaaagagcaagcatgagtccatgatctcagagctagag
gtgaggctgaagaaagaggagaagagccggcaggagctggagaaactcaagaggaaactg
gagggtgatgccagtgacttccacgagcagatcgctgacctgcaggcccagattgcagag
ctcaagatgcagctggcaaagaaagaggaagagctacaggcagctctagccaggctcgat
gaagagatcacccagaaaaacaatgccctaaagaagattcgagagctggagggccatgtc
tcagacctacaggaggacctggactcagagcgagctgctaggaacaaggctgagaaacag
aagcgagacctgggggaggaactggaggcgctcaagacagagctggaagatacactggac
agcacagctacccagcaggagctcagagccaagagggaacaggaagtgacaatgctgaag
aaggccctggatgaagagacgcgatcccatgaggcccaggtccaggagatgaggcagaag
cacacacaggcagtggaggaactcacagagcagctggaacagttcaaaagggccaaggca
aacctggataaaagcaagcagacgctggagaaggagaacgcagacctggctggggagctg
cgtgtcctgggccaggcaaagcaggaggtagagcacaagaagaagaagctggaggggcag
ctgcaggagctgcagtccaagtgcagtgatggggagcgtgcccggactgagctcagtgac
aaggtccacaaactacagaatgaagtggagagtgtcacaggcatgctcaatgaggcagaa
ggcaaggccattaaactggccaaggaagtggcttcccttggatctcaacttcaggacacc
caagagctgcttcaagaagaaacccggcagaagctcaatgtgtccaccaagctgcgccag
ttggaagatgagaggaacagcctgcaggaccagctggatgaggagatggaagctaagcaa
aaccttgagcgccatgtctccaccttgaacattcagctctcagactctaagaagaagctg
caggaccttgcaagcactattgaggtcatggaggaggggaagaagaggttgcagaaagag
atggagggtctcggccagcagtatgaggagaaggccgctgcctatgacaaactggagaaa
actaagaacaggcttcagcaggagctagatgacttggtcgtggacttggacaaccagcgg
caactggtatccaatctggaaaagaagcagaagaaattcgatcagttgttagctgaggaa
aagaacatctcctccaagtatgcggatgagagagaccgagctgaagcagaggccagggaa
aaggaaacgaaggctttgtctctggcccgggccctggaggaagccctggaagccaaagag
gaactggaaaggaccaacaagatgctcaaggccgagatggaagacctggtcagctccaag
gatgacgtgggcaagaatgtgcacgagctggagaagtccaaacgagccctggagacccag
atggaagagatgagaactcagctagaggagctggaggacgagctgcaggccactgaagac
gccaagctgcggctggaggtcaacatgcaggccctcaagggccagtttgaacgagatctc
caggctcgggatgagcagaatgaggagaagaggaggcagctacagcggcagctgcatgag
tatgagacagaactggaagatgaacggaagcaaagggctctggcggcagcagccaagaag
aagctggaaggggatctgaaagacctggaactccaggctgactcagccgtcaaagggagg
gaggaagccatcaagcagcttcgaaaactgcaggctcagatgaaggacttccaaagagag
ctggatgatgcccgtgcctccagagatgagatctttgccacctcaaaagagaatgagaag
aaagccaagagtctggaggcagagctcatgcagctccaggaggacctggcagcagctgag
agagctcgcaagcaagctgacctggagaaggaggagctggctgaggagctggctagcagc
ttatcaggaaggaatacactgcaggatgagaagcgccgcctggaggcaaggatcgcccag
ctggaggaggagctggaggaagagcagggcaacatggaggccatgagtgacagagtccgc
aaggccacattgcaggctgagcaactgagcaatgagctggtcactgagcgcagtgcagct
cagaagaatgagagtgcacggcaacagctggagcgccagaacaaggaactccgaagcaag
ttgcaggaggtagaaggtgctgtcaaagccaagcttaagtccactgttgcggcactagag
gccaagattgtgcagctggaggagcagattgaacaagaggccagagaaaaacaggcagcc
accaagttgctgaagcaaaaggacaagaagctaaaggaggtcctactgcaggtggaggat
gagcgcaagatggtggagcagtacaaggagcaggcagagaaaggaaacaccaaggtcaag
cagctcaagaggcagctggaagaggccgaggaggaatcccagcgcatcaatgccaaccgc
aggaagctgcagcgggagctggatgaggccactgagagcaatgaggccatgggccgtgag
gtgaatgccctcaagagcaaactcaggagaggaaacgaggcttcatttgttccttccaga
agggctggaggccgtagagttattgaaaacacagatggttctgaagaagaaatggatgct
cgggactcagacttcaatggaaccaaagccagtgaataa

KEGG   Rattus norvegicus (rat): 25745
Entry
25745             CDS       T01003                                 

Gene name
Myh9
Definition
(RefSeq) myosin-9
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    25745 (Myh9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    25745 (Myh9)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    25745 (Myh9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    25745 (Myh9)
   04147 Exosome [BR:rno04147]
    25745 (Myh9)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     25745 (Myh9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   25745 (Myh9)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ CC2-LZ Crescentin ADIP AAA_22
Other DBs
NCBI-GeneID: 25745
NCBI-ProteinID: NP_037326
RGD: 3140
Ensembl: ENSRNOG00000004860
UniProt: G3V6P7
Position
7
AA seq 1960 aa
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSTKNGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLRLRNWQWWRLFTKVKPLLNS
IRHEDELLAKEAELTKVREKHLAAENRLTEMETMQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQYLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRVAEFTTNLMEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELETQISELQEDLESERACRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVSILKKTLEDEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKATLEKAKQTLENERGELANEVKALLQGKGDSEHKRKKVEAQLQELQVK
FSEGERVRTELADKVSKLQVELDSVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQMEDEKNSFREQLEEEEEAKRNLEKQIATLHAQVTDMKKKMEDGVGCL
ETAEEAKRRLQKDLEGLSQRLEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSIAMAARKKLEMDLK
DLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKAKLQEMESA
VKSKYKASIAALEAKIAQLEEQLDNETKERQAASKQVRRAEKKLKDVLLQVEDERRNAEQ
FKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDMPFVVTRRIVRKGTGDCSDEEVDGKADGADAKAAE
NT seq 5883 nt   +upstreamnt  +downstreamnt
atggcccagcaggctgcagacaagtacctctatgtggataaaaacttcatcaataacccg
ctggcccaggccgactgggctgccaagaagctggtatgggtgccttccaccaagaatggc
tttgaaccagccagccttaaggaggaggtgggagaagaggccattgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgatatccagaagatgaacccacccaagttc
tccaaggtggaggacatggcagagctcacgtgcctcaacgaagcctcggtgctgcacaac
ctcaaggagcgatactactcagggctcatctatacctattcaggcctgttctgtgtggtc
attaatccttataagaacctgcctatctactcagaggagatcgtggacatgtacaagggc
aagaagaggcacgagatgccgccccacatctatgccatcacagacactgcctacaggagc
atgatgcaggaccgagaagatcagtccatcctttgcacgggtgagtctggagcaggcaag
acagagaacaccaagaaagtcatccagtacctggcacatgtggcctcctcacacaagagc
aagaaggaccagggggagctggagcgccaactgctgcaggccaaccctatcctagaggcc
tttggaaacgccaagacggtgaagaatgacaactcttcacgatttggtaaattcattcgt
atcaactttgatgtcaacggctacatcgttggggccaacattgagacttatcttctggag
aaatctcgtgctatccgccaagccaaggaggaaagaaccttccacattttctattacctg
ctgtctggggccggagagcacctgaagactgatctcctgttggagccatacaataaatac
cgcttcctgtccaatgggcatgtcaccatcccagggcagcaggacaaggacatgttccag
gagacaatggaggccatgaggattatgggtatcccagaggatgagcagatgggcttgctg
cgggtcatctctggcgtccttcagcttggcaacattgtcttcaagaaggaacggaacact
gaccaggcgtccatgccagataacacagctgctcaaaaggtgtcccacctcctggggatc
aatgtgaccgacttcaccagaggcatccttaccccgcgcatcaaggtgggcagagactat
gtgcagaaggcacagactaaagagcaggctgactttgccatcgaggctttggccaaggct
acctacgagcggatgttccgctggctggtgcttcgcattaacaaagctctggacaagacc
aagaggcagggcgcctcatttatcgggatcctggacatcgctggcttcgagatctttgat
ctgaactccttcgagcaactttgcatcaactataccaacgagaagctgcagcagctgttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgagagggcatcgagtggaac
ttcatcgactttggccttgacctgcagccttgcatcgacctcattgagaagccggcgggt
cccccaggcatcctggccctgttagatgaggaatgttggttccctaaagccactgacaag
agcttcgtggagaaggtggtgcaggagcagggcacccaccccaagttccagaagcccaag
caactgaaggacaaggctgatttctgcatcatccactatgcaggcaaggtggactataag
gccgatgagtggctgatgaagaacatggaccctctgaacgacaacattgccaccctgctt
caccagtcctcagacaagtttgtctctgagctgtggaaggatgtggatcgaatcattggc
ttggaccaggtggctggaatgtctgagacagcgctacccggtgccttcaagactcggaag
ggcatgttccgtactgtggggcagctgtacaaggagcagctggccaagctcatggccaca
ctgaggaataccaatcccaactttgtccgctgcatcattcccaaccacgagaagaaggcc
ggcaaactggacccacacctggtgctggaccagttacgctgcaatggcgtccttgaaggc
atccgaatctgccgccagggctttcccaacagagtggtcttccaggagttccggcagagg
tatgagatcctcacacctaactccattccgaagggcttcatggatgggaagcaggcgtgt
gtgctcatgatcaaagccttggagcttgacagcaacctgtaccgcatcggccagagcaaa
gtgttcttccgggccggagtcctagctcacctggaggaagagcgggacctgaagatcact
gatgtcatcattggcttccaggcctgctgcagaggctacctggccaggaaggcctttgcc
aagaggcagcagcagctgactgccatgaaggtcctacagaggaactgtgctgcatacctc
agactccgcaactggcagtggtggaggctcttcaccaaggtcaagcccctgctgaactca
ataaggcatgaggatgagcttttagccaaggaggcggaactgacaaaagttcgagagaag
catctggctgcagagaacaggctgacagagatggagactatgcagtctcagctcatggca
gagaagttgcagcttcaggagcagctgcaggcggaaacagagttgtgtgccgaggctgag
gagctccgggcccgcctgacagcgaagaagcaggagttggaggagatctgccatgacctg
gaggccagggtagaggaggaggaggagcgctgccagtatctgcaggcagagaagaagaag
atgcagcagaacatccaggaactcgaggagcagctggaggaggaggagagtgcccggcag
aagctgcagcttgagaaggtgaccactgaggccaagctgaagaaactggaggaggaccag
atcatcatggaggatcaaaactgcaaactggccaaggagaagaagctgctggaagacaga
gtagctgaatttactacaaacctcatggaagaggaggagaagtccaagagcctggccaaa
ctcaagaacaagcacgaggcgatgatcaccgacctggaagagcgccttcgtagggaggag
aagcaaaggcaggagttggagaagacccgccgcaagctagagggagactccacagacctc
agcgaccagattgctgagctccaggcgcagatcgcagagctcaagatgcagctggccaag
aaggaggaggaattgcaggctgccttggccagagtggaagaagaagctgctcagaagaac
atggccctgaagaagattcgagaactggaaactcagatctctgagctgcaggaagacctg
gagtcggagcgagcctgcaggaacaaagctgagaagcagaaacgggatcttggagaagag
ctagaggctctgaagacagagctggaggacactctggactccaccgctgcccagcaggaa
ctgaggtcaaagcgtgagcaggaagtgagcatcctgaagaagactcttgaggatgaggcc
aagacccatgaggcccagatccaggagatgaggcagaagcactcgcaggccgtggaggag
ctggccgagcaattggagcagactaagcgggtaaaagctacccttgagaaggcgaagcag
accctggagaatgagcggggagagctggccaatgaggtgaaggccttgctgcagggcaag
ggcgactcggagcacaagcgcaagaaggtggaggcgcagctgcaagaactgcaggtcaag
ttcagcgagggagagcgtgtacggaccgagctggctgacaaggtctccaagctgcaggtt
gaactggacagcgtgactggtctccttaaccagtcggacagcaagtccagcaagcttaca
aaggacttctctgcgctggagtcccagctccaggacacacaggagctgctccaggaggag
aaccggcagaagctgagcctcagcaccaagctcaagcagatggaggatgagaaaaactcc
ttcagagagcagctggaggaggaagaggaggccaagcgcaacctggagaagcagatcgcc
accctccatgcccaggtgactgatatgaagaagaagatggaggacggtgtagggtgcctg
gagacagcagaggaggcaaagcggaggcttcagaaggacctggaaggcctgagccagcgg
cttgaggagaaggtggctgcctatgataagctggagaagaccaagacccggcttcagcag
gagctggatgacctgctggtggacctggaccaccagcggcagagcgtctccaacctggaa
aagaagcagaagaagtttgaccagctcctagctgaggagaagaccatctcagccaagtat
gctgaggagcgagaccgagctgaggctgaggcccgtgagaaggagacaaaggcactgtca
ctggcccgggcacttgaggaggccatggagcagaaggcagagctagaacggctcaacaag
cagttccgcacggagatggaggacctcatgagctccaaggatgacgtgggcaagagcgtc
catgagctggagaagtccaagagggcattggagcagcaggtcgaggagatgaagacccag
ctggaggagctggaggatgagcttcaggccactgaggatgccaagctccgtctggaggtg
aacctgcaggccatgaaggcccagtttgagcgggatctgcagggccgggatgaacagagc
gaggagaagaagaagcagctggtcagacaggtgcgggagatggaggcggagctggaggat
gagaggaagcagcggtccattgccatggctgctcgcaagaaactagagatggatctgaag
gacctggaggctcacatagacacagccaacaagaaccgggaggaggccatcaaacagcta
cggaagcttcaggcccagatgaaggactgcatgcgggagctggacgacacgcgagcctcc
cgggaggagatcctggcccaggccaaggagaatgagaagaagctcaagagcatggaggcc
gagatgattcagctgcaggaggaactggcagccgccgagcgtgctaaacgccaggcccaa
caggagcgggatgagctggccgatgagatcgccaacagcagtggcaaaggggccctagca
ttggaggagaagcggcgactagaggcccgcattgcccagctggaggaagagctggaggag
gagcagggcaacacagaactgatcaacgaccggctgaagaaggccaatctgcagatcgac
caaataaacaccgacctgaacctggagcgcagccacgcccagaagaacgagaatgcgcgg
cagcagctggaacgccagaacaaggagctcaaggccaagctgcaggagatggagagtgct
gtcaagtccaaatacaaggcctccatcgctgccttggaggccaagattgcacagctggag
gagcagctggacaacgagaccaaggagcgccaggcagcctccaagcaggtgcgccgggcg
gagaagaagctgaaggatgtgctgctgcaagtggaagacgagcggaggaacgcggagcag
ttcaaggaccaggccgacaaggcatccactcgcctgaagcagcttaagcggcagctagag
gaggccgaggaggaggcccagcgggccaatgcctcccgccggaagctgcagcgtgagctg
gaggatgccacagagactgccgatgctatgaaccgagaggtcagctccctgaagaacaaa
ctgaggcgtggggacatgccatttgttgtgacccgccgaattgtccggaaaggcactggc
gactgctcagacgaggaggtcgacggtaaagcagacggggctgatgccaaggcagccgag
tag

KEGG   Rattus norvegicus (rat): 308572
Entry
308572            CDS       T01003                                 

Gene name
Myh14
Definition
(RefSeq) myosin-14
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    308572 (Myh14)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    308572 (Myh14)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    308572 (Myh14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    308572 (Myh14)
   04147 Exosome [BR:rno04147]
    308572 (Myh14)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     308572 (Myh14)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   308572 (Myh14)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N ADIP IQ AAA_22
Other DBs
NCBI-GeneID: 308572
NCBI-ProteinID: NP_001094160
RGD: 1306821
Ensembl: ENSRNOG00000020014
UniProt: F1LNF0
Position
1
AA seq 2000 aa
MATVTLSVPGRKVASRPGPVPEAAQPFLFAPRTPNVGGPGGPQVEWTARRMVWVPSELHG
FEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHN
LRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHIYAVTEGAYRS
MLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPASVSTMSYGELER
QLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDIAGYIVGANIETYLLEKSRAIRQAK
DECSFHIFYQLLGGAGEQLKADLLLEPYSHYRFLTNGPSSSPGQERELFQETLESLRVLG
LLPEEITAMLRTVSAVLQFGNIVLKKERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALL
TPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGI
LDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQP
CIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGSHPKFQRPRNLRDQADFSV
LHYAGKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDG
PPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQL
RCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPN
LYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQRRQQQQSALRVM
QRNCAAYLKLRNWQWWRLFIKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQ
GRVAQLEEERARLAEQLRAEAELCSEAEETRARLAARKQELELVVTELEARVGEEEECSR
QLQSEKKRLQQHIQELETHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSK
ERRLLEERLAEFSSQAAEEEEKVKSLNKLRVKYEATIADMEDRLKKEEKGRQELEKLKRR
LDGESSELQEQMMEQKQRAEELLIQLGRKEEELQSALVRAEEEGGARAQLLKSLREAQAG
LAEAQEDLEAERVARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTEL
KKTLEEEARTHEVAMQELRQRHSQALVELTEQLEQARRGKSVWEKTRLSLEAEVSELKTE
LSSLQTSRQEGEQKRRRLESQLQEVQGRSSDSERARAEAAEKLQRAQVELESVSTALSEA
ESKAIRLSKELSSAESQLHDTQELLQEETRAKLALGSRVRALEAEAAGLREQMEEEVVAR
ERAGRELQTTQAQLSEWRRRQEEEAAVLEAGEEARRRAAREAETLAQRLAEKTEAVERLE
RARRRLQQELDDATVDLGQQKQLLSTLEKKQRKFDQLLAEEKAAVLRAVEDRERVEAEGR
EREARALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKNVHELERARRVAEQ
AASDLRTQVTELEDELTAAEDAKLRLEVTVQALKAQHERDLQGRDDAGEERRRQLAKQLR
DAEVERDEERKQRALAMAARKKLELELEELKAQTSAAGQGKEEAVKQLKKMQAQMKELWR
EVEETRSSREEMFTLSRESEKRLKGLEAEVLRLQEELAASDRARRQAQQDRDEMAEEVAS
GNLSKAATLEEKRQLEGRLGQLEEELEEEQNNSELLKDHYRKLVLQVETLTTELSAERSF
SAKAESGRQQLERQIQELRARLGEEDAGARARQKMLIAALESKLAQAEEQLEQESRERIL
SGKLVRRAEKRLKEVVLQVDEERRVADQLRDQLEKSNLRLKQLKRQLEEAEEEASRAQAG
RRRLQRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEEAEG
AEPGSAPTQEPEAPPPAAPQ
NT seq 6003 nt   +upstreamnt  +downstreamnt
atggccacagtgaccttgtccgtgcctgggaggaaggtggcctccaggccaggcccggtg
cctgaggcagcccagccattcctgttcgcgccccggacgccaaatgtaggtggccctgga
gggccacaggtggagtggacagcacggcgcatggtgtgggtgccctcggaactgcatggg
ttcgaggcagcagccctgcgggatgaaggggaggaggaggcagaagtggagctggcggag
agtgggcggcgcctgcggctgcccagggaccagatccagcgcatgaacccacccaagttc
agcaaggcagaagatatggctgagctcacctgcctcaacgaggcctcggtcctgcacaat
ctgcgagagcgctactactctgggctcatttatacctactctggcctcttctgtgtggtc
attaacccgtacaagcagctgcctatctacacggaggccattgttgaaatgtaccggggc
aagaagcgccacgaggtgccacctcacatctatgccgtgaccgagggcgcgtaccgcagc
atgcttcaggatcgtgaggatcagtccattctctgcacgggagagtctggagctgggaag
acggagaacaccaagaaggtcatccagtacctggcccatgtggcatcatctccaaagggc
aggaaggaacctggtgtccctgcctccgtcagcaccatgtcttatggggagctagagcgg
cagcttcttcaagccaaccccatcctagaagccttcggcaatgccaaaacggtgaagaac
gacaactcttcccgatttggcaaattcatccgcatcaactttgatattgctggctacatc
gtgggagcaaacatcgagacctatctgctggagaagtcccgggccatcagacaggccaag
gacgaatgcagcttccatatcttctaccagctgctagggggcgctggggagcagctaaaa
gctgacctccttctggagccctactcccattaccgcttcctgaccaacgggccctcatca
tcccccggccaggagcgggagttattccaggagaccctggagtccctgcgagtgctgggc
ctcctcccagaagagatcactgccatgctgcgcacagtctcagctgtcctccagtttggc
aacattgtcctgaagaaagagcggaacacggatcaagccaccatgcctgacaacacagct
gcccagaagctttgccgcctcttgggacttggagtgactgacttctccagagcccttctc
acgccccgcatcaaagtcggccgagattacgtccagaaagcacagaccaaagagcaggct
gactttgcgctggaggctctggccaaagctacctatgagcgcctgttccgctggctggtt
ctgcggctcaaccgtgccctggacagaagcccacgtcagggcgcctccttcctgggcatc
ctggacatcgcaggctttgagatcttccagctgaactccttcgagcagctgtgcatcaac
tacaccaatgagaagctgcagcagctgttcaaccacaccatgttcgtgctggagcaggag
gagtaccagcgagaaggcatcccctggaccttcctggactttgggttggacctgcagcct
tgtatcgacctcattgagcggccggccaaccctccaggtctcctggccctgctggacgag
gagtgctggttccccaaggccactgacaagtcttttgtggagaaggttgcccaggagcag
ggcagccaccccaagttccagcgtcctaggaacctacgagatcaagcggacttcagcgtc
ctgcactacgcaggcaaggttgactacaaagccaatgagtggttgatgaagaacatggat
ccattgaatgacaatgtggccgccttgcttcaccagagcacagatcgtctcacagctgag
atctggaaggatgtggagggcatcgtggggctggagcaagtgagcagccttggagatggc
cccccgggaggccgcccccgccgtggaatgttccggaccgtggggcagctctacaaagaa
tccctgagccgcctcatggccacgctcagcaacaccaaccctagttttgtccgctgcatc
gttcccaatcatgagaagagggctgggaaactggagccgcgcctggtgctggaccagctc
cgttgtaatggtgtcctcgagggtatccgcatctgtcgccaaggtttccccaaccgcatc
ctctttcaggagttccggcagcgctatgaaatcctcaccccgaacgccattcccaagggc
ttcatggacggcaaacaggcctgtgagaagatgatccaggccctggagctagaccccaac
ttgtaccgtgttggccaaagcaagatcttcttccgggcaggggtcctagctcaactggag
gaggagcgagatctcaaggtcaccgacatcatagtatcttttcaggcagcggcacggggc
tacctggcccgtagggctttccagaggaggcagcagcagcagagtgctctgagggtgatg
cagagaaactgtgccgcctacctcaagctgaggaactggcagtggtggagactgttcatc
aaggtgaagcccctgctgcaggtgacacggcaggatgaggtgctgcaggcgcgagcccag
gagctacagaaagttcaggagctgcagcagcagagcgcccgtgaagtgggggaactgcag
ggtcgagtggcacagctagaggaggagcgtgcgcgcctggctgagcagctgcgagcggaa
gcggagctgtgctctgaggcggaggagacacgggcacgattggctgcccggaagcaggag
ctggagctggtggtgacagagctggaggcacgagtgggcgaggaagaagagtgcagccgg
cagctacagagcgagaagaagaggctgcagcagcacatccaggagctggagacccaccta
gaagcagaggagggtgcccggcagaaactgcagctggagaaagtgaccacagaggccaag
atgaagaagtttgaggaggatctgctgctcctggaagaccagaattccaagctgagcaag
gagcggaggctgctggaggagcgcctggctgagttctcctcacaggcagcagaagaggaa
gagaaagtcaaaagccttaacaagctgagggtcaaatatgaagccacaatcgcagacatg
gaagaccgactgaagaaagaggagaaaggccgccaggaactagagaagctgaagcgacgg
ctggatggggagagctcagagcttcaggaacagatgatggagcagaagcagagggcagag
gagctgctcatacagctgggccgcaaggaggaagagctgcagtcggccctggtcagggca
gaggaggagggtggtgcccgtgctcagctgctcaagtctctgcgagaggcacaggctggc
cttgctgaggcccaggaggacctggaagctgagcgggtagccagggccaaggcggagaag
cagcgccgggacctgggcgaggagttggaggcgctccgcggggagctagaggacacgctg
gattccaccaacgcccagcaggagctgcggtccaagagggagcaggaggtgacagagctg
aaaaagactttggaagaggaggcccggactcacgaggtggccatgcaggagctgagacag
aggcatagccaggccctggtggagctgacagagcagttggagcaagcacggaggggcaaa
agtgtgtgggagaagacccggctctccctggaggctgaggtgtctgaacttaagacggag
ctgagcagcctgcagacctcaagacaggagggtgagcagaagaggcgacgcctggagtcc
cagctacaggaggtccagggccgatccagcgattccgagagggctcgggctgaggctgct
gagaagctacagagagcccaggtggaacttgagagcgtgtccacagccctaagtgaggct
gagtccaaggccatcaggctgagcaaggagctgagcagtgcagagtcccagctgcacgac
acccaggaactgctgcaggaggagaccagggcaaagctggctttggggtcccgtgtgcgt
gccctggaggccgaggcagccgggcttcgggagcagatggaagaggaggtggttgccagg
gaacgggctggccgagagctgcagaccacacaggcccagctctctgaatggcggcgacgc
caggaagaagaggctgccgtgctggaggctggggaggaggctcggcgccgtgcagcccgg
gaggcagagaccctggcccagcgcctggcagaaaagactgaggctgtagaaagactggag
cgagcccggcggcggctgcagcaggagctggacgacgccactgtggacctggggcagcag
aaacagctcctgagcacactggagaagaagcagcgaaagtttgaccagctcctggcagag
gagaaggctgcagtgctacgggctgtggaagatcgtgaacgggtagaggctgaaggccgg
gagcgagaggcccgggccctgtcgctgacacgggccctggaagaggagcaggaggcacgg
gaggagctggagaggcagaaccgtgctctgcgggctgagctggaggcactgctaagcagc
aaggatgatgttggcaagaatgtgcacgagctcgagcgagcccgcagggtggctgaacag
gcagccagtgacctgcggacacaggtgacagaactggaggatgagctgactgccgcggag
gatgccaaactgcgcctggaggtgactgtgcaggccctgaaggctcaacatgaacgcgac
ctgcagggccgtgatgatgctggcgaggagaggcggaggcagctggccaagcagctgaga
gacgcagaggtagagcgcgatgaggaacggaagcagagggcactggccatggctgcccgc
aagaagctggagttggaactggaggagttgaaggcacagacatctgctgctgggcagggc
aaggaagaggcagtgaagcagctgaagaagatgcaggcccagatgaaggagctgtggcgg
gaggtggaggagacgcgtagctcccgcgaggagatgtttaccctgagcagggaaagtgag
aagaggctcaaggggttggaagctgaggtgctgcggctgcaggaggaactggctgcctca
gaccgagcccggaggcaggcacagcaggacagagatgagatggcagaggaggtggccagt
ggcaaccttagcaaggcagccaccctggaggagaaacggcagctggaggggcgactgggc
cagttggaagaggagctggaggaagagcagaataactcggagctgctcaaggaccactac
cgaaagctggtgctacaggtagagaccctcaccacagagctgtctgctgaacgcagtttc
tcagccaaggctgagagtggaaggcagcagctggagcggcagatccaggaactgcgggcc
cgcctgggtgaagaggatgctggagccagagccaggcagaaaatgctgatcgccgctctt
gagtctaaactggcccaggcagaggagcagctggagcaggagagcagagagcgcatcctc
tctggcaagctggtacgcagagccgagaagcggctgaaggaggtggttcttcaggtggat
gaagagcgcagggtggctgaccagctccgggaccagctggagaaaagcaacctccggctg
aagcagctcaagagacagctggaggaggcagaggaggaagcatctcgggcacaggctggc
cggaggcgtctgcagcgggagctggaggacgtcactgagtctgcagaatccatgaaccgg
gaggtgaccacgctgaggaacaggctccggcgtggcccgcttactttcaccacgcgaact
gtgcgccaggtgttccggctggaagagggcgtggcttccgacgaggaagaggctgagggg
gcagagcctggttctgcaccaacccaggagcctgaggctccgccccctgccgctccccag
tga

KEGG   Rattus norvegicus (rat): 79433
Entry
79433             CDS       T01003                                 

Gene name
Myh10
Definition
(RefSeq) myosin-10
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    79433 (Myh10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79433 (Myh10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    79433 (Myh10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    79433 (Myh10)
   04147 Exosome [BR:rno04147]
    79433 (Myh10)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     79433 (Myh10)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   79433 (Myh10)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP CC2-LZ AAA_22
Other DBs
NCBI-GeneID: 79433
NCBI-ProteinID: NP_113708
RGD: 71000
Ensembl: ENSRNOG00000002886
UniProt: Q9JLT0
Position
10
AA seq 1976 aa
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEVLLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQVDE
LKVQLTKKEEELQGALARGDDETLHKNNALKVARELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEDETKNHEAQIQDMRQR
HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGMKFAKDAAGLESQLQDT
QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV
DDDLGTIEGLEEAKKKLLKDVEALSQRLEEKVLAYDKLEKTKNRLQQELDDLTVDLDHQR
QIVSNLEKKQKKFDQLLAEEKGISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLLKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNTELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHIEGASLELSDDDTESKTSDVNETQPPQSE
NT seq 5931 nt   +upstreamnt  +downstreamnt
atggcccagagaactggactggaggatcccgagaggtatctctttgtggacagggctgtc
atctacaaccctgccactcaagctgactggacagctaaaaagctggtgtggattccatct
gaacgccatggttttgaggcagctagtattaaagaagaacggggcgatgaggttatggtg
gagctggcagagaacgggaagaaagcgatggtcaacaaagatgacattcagaagatgaac
ccgccgaagttctccaaggtggaggacatggcagagctcacgtgcttgaacgaagcctct
gttttacacaatctgaaggatcgctactattcaggactcatctatacttactctggactc
ttctgtgtggtgataaatccctacaagaaccttccgatttactctgagaatattattgag
atgtacagagggaagaagcgccatgagatgccgccacacatctacgccatatcagagtct
gcctacagatgcatgcttcaagatcgtgaggaccagtcgattctttgcacgggtgaatca
ggtgccgggaagacagaaaatacaaagaaagtcattcagtaccttgcccacgttgcttct
tcacacaaaggaagaaaggaccacaatattcctggggaacttgaacggcagcttttacaa
gcaaatccaattctggaatcatttggaaatgcgaagactgtgaaaaatgataactcatct
cgctttggcaagtttatccggatcaactttgatgtaaccggctatattgttggggccaac
attgaaacataccttctggaaaagtcccgtgctgttcgtcaagctaaagatgaacgcacg
tttcatatcttttatcagttgctctctggagcaggggaacacctgaagtccgacttactc
ctggaaggctttaataactacagattcctctccaacggctacatccctattcctggacag
caagacaaggataactttcaggagaccatggaagccatgcacataatgggcttctctcac
gaagagatcctctcaatgcttaaagtcgtgtcttcagtgctgcagtttggaaacatctct
ttcaaaaaggagaggaacactgaccaagcttccatgcccgagaacacagttgcacagaaa
ctctgccacctgcttgggatgaatgtgatggagttcactcgggctatcctcacgcccagg
atcaaagttggccgagattatgtacagaaagcccagaccaaagagcaggcagattttgca
gtggaagcattggcaaaggctacctatgagcggttgtttcgctggctcgttcaccgcatc
aataaggcgctggataggaccaaacgccagggagcgtctttcattgggatcctggatatt
gctggttttgaaatttttgagctgaactcctttgaacaactatgcatcaactacaccaat
gagaagctgcagcagctgttcaaccacaccatgttcatcctggagcaggaggagtaccag
cgagagggcatcgagtggaacttcatcgactttggtctcgacttgcagccctgcatcgac
ctgatagagagacctgccaatccccctggtgtgctggccctcctggatgaagaatgctgg
ttccccaaagccacagacaaaacgtttgttgagaagctggttcaggagcaaggttcccac
tccaagtttcagaaaccacggcaactgaaagacaaagccgacttctgcatcatccactat
gcagggaaggtggactataaggcggatgagtggctgatgaagaacatggaccccctgaat
gacaacgtggccaccctcctgcaccagtcatcagacagatttgtcgccgagctttggaag
gatgtggaccgaattgtaggtctggatcaagtcactggcatgactgagacagcttttggc
tctgcatataaaaccaagaagggcatgttccgcaccgtcgggcagctctacaaagagtct
ctcaccaagctcatggcaaccctccgaaacaccaaccccaacttcgtacgctgcatcatt
ccaaatcacgagaagcgggctggaaaactggatccacatctcgtgctggatcagctccgc
tgtaacggtgtcctggaaggaatcaggatctgtcgccagggattccccaaccggatagtt
ttccaggagttcagacagagatatgagatcctaactcccaacgctattcccaaaggcttc
atggatggcaaacaggcctgtgagcgaatgatccgagctttagaactggacccaaacctg
tatagaattggacagagcaagatatttttccgagctggagttctggcgcacttagaggaa
gaaagagatttaaaaatcactgatataatcatctttttccaagctgtatgcagaggctac
ctagccagaaaggcctttgccaagaaacagcagcagctaagtgccttaaaggtcttgcag
cggaactgtgcggcgtacctgaagctgcgacactggcagtggtggcgcgtcttcacaaag
gtgaagcctctcctccaagtgacccgccaggaggaggagctccaggctaaagatgaggag
ctgctgaaggtgaaagagaagcagacaaaagtggaaggggaacttgaggagatggaacgg
aagcaccagcagctgctggaagagaagaatatcctggcagaacagctgcaggccgagact
gagctctttgctgaagcagaggagatgagagcaagactcgctgccaagaagcaggaactg
gaggagatcctccatgacctggagtccagggtggaggaggaggaagagcgaaaccagatc
ctgcagaacgagaagaagaagatgcaagcgcacattcaggatctagaagagcaactggat
gaggaggagggggcgcggcaaaagctgcagctggagaaggtgaccgcggaggctaaaatc
aagaagatggaagaggaggttctgcttctcgaggaccagaattccaaatttatcaaagaa
aagaaactcatggaagatcgaattgctgagtgttcctctcagctggctgaagaggaagaa
aaggcaaaaaacttagccaaaatcaggaataagcaagaagtgatgatctcggatttagaa
gaacgcttgaagaaggaggagaaaacacggcaggaactggaaaaggccaaacggaaactg
gacggtgaaacaactgatctgcaggaccagatcgccgagttgcaagcacaggtcgatgag
ctcaaagtccagttgaccaagaaggaggaggagcttcagggggcgctggccagaggagat
gatgagacgctgcacaagaataatgcgcttaaagttgcgcgggagctgcaggcccaaatc
gccgagctccaggaagactttgagtctgaaaaggcttcaaggaacaaggctgagaaacaa
aaacgggacctgagtgaggagctggaagctctaaagacagaactggaggacaccctagac
accacagcagctcagcaggaactccgcacaaagcgggagcaggaagtagctgagctgaag
aaggctcttgaggatgaaactaagaaccacgaagctcagatccaggacatgagacagagg
cacgccacggcactggaggaactctctgagcaactggaacaggctaagaggttcaaagcc
aatctggagaagaacaaacagggcctggagacggacaacaaggagctggcgtgtgaggtg
aaggtgctgcagcaagtcaaggctgagtcagagcacaagaggaagaagctcgatgcccag
gtccaggagctccacgccaaggtgtcagaaggtgacaggctcagggtagaactggccgag
aaagcaaacaagctacagaatgagctggataatgtctcaaccctgctggaagaagccgag
aagaaaggaatgaagttcgctaaggacgccgcaggtctcgagtctcagctacaggacaca
caggagctccttcaggaggagacgcggcagaaactgaacctgagcagtcggatccggcag
ctggaggaggagaagaacagccttcaggagcagcaggaggaggaagaggaggccaggaag
aacttggaaaagcaggtgttggccctgcagtcccagctggctgacaccaagaagaaagtg
gacgatgacctggggacaattgagggtttggaagaagccaagaagaaactgcttaaggac
gtggaggcactgagtcagcgactggaggaaaaggtcctagcatatgacaagctggagaag
accaagaaccggctgcaacaggagctggatgacctgacggtggacctggaccaccagcgc
cagatcgtctccaacttggagaagaaacagaagaagtttgaccagctgttggcagaagag
aagggcatctctgctcgctatgcagaagaacgggaccgggctgaagctgaggccagagag
aaagaaaccaaggcgctctccctggcgcgggccctggaggaggccttggaggccaaggag
gaattcgagaggcagaataagcagcttcgggcagacatggaagacctcatgagctcgaaa
gatgatgtggggaagaacgtccacgagctggagaagtccaagcgggccctggagcagcag
gtggaggagatgaggacccagctggaggagctggaggacgagttgcaggccactgaggac
gccaaactccgcctggaagtcaacatgcaggccatgaaggcccagtttgagagggacctg
caaaccagagatgagcagaatgaagagaagaagcggctgctgctcaagcaggtacgggag
ctcgaggcagagctggaggatgagcggaagcagcgggcacttgctgtggcttcaaagaag
aagatggagatagacctgaaggacctggaggctcagatcgaggccgccaacaaggcccgg
gatgaagtgatcaagcagcttcgcaagcttcaggcacagatgaaggattaccagcgtgaa
ctagaagaagctcgagcatctagagatgagatttttgctcaatccaaagaaagtgaaaag
aaactgaagagtctagaagcagaaatcctccagttgcaagaggagctggcctcatctgag
cgagcccgcagacacgcagagcaggagcgagatgagctggctgacgagattgccaacagc
gcctctgggaagtccgctctgctggatgagaagcggcgcctggaagcccggatcgcgcag
ctggaggaggagctagaagaggagcagagtaacatggagctgctcaatgaccgcttccgc
aagaccacgctccaggtggacaccctgaacacagagttggcagcggagcgcagcgctgcc
cagaagagcgacaatgcccgccagcagctggagcgacaaaacaaggagctgaaggccaag
ctgcaggagctggagggggcggtcaagtccaagttcaaagccaccatctcagccctggaa
gccaagattgggcagctggaggaacagctggagcaggaagccaaggaacgcgcagctgcc
aacaaactagtccgtcggacagagaagaaactgaaagagatcttcatgcaggtcgaagac
gagcgccggcatgcggatcagtataaggagcagatggagaaagccaatgccaggatgaag
cagcttaaacgccagctggaagaagctgaggaggaggctacacgtgccaatgcatctcgg
cgtaaactccaaagggaactggatgatgccaccgaggccaatgagggcctgagccgtgag
gtcagcactctcaagaaccggcttaggcggggcggcccaatcagcttttcttcaagccga
tctggccggcgccagctacacattgagggggcatcgctagagctgtcagatgacgacaca
gaaagcaagaccagtgatgtcaatgagacacagccaccccagtcggaatag

DBGET integrated database retrieval system