KEGG   Rattus norvegicus (rat): 24584
Entry
24584             CDS       T01003                                 

Gene name
Mylpf
Definition
(RefSeq) myosin regulatory light chain 2, skeletal muscle isoform
  KO
K12758  fast skeletal myosin light chain 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24584 (Mylpf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24584 (Mylpf)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    24584 (Mylpf)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    24584 (Mylpf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24584 (Mylpf)
   04147 Exosome [BR:rno04147]
    24584 (Mylpf)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     24584 (Mylpf)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24584 (Mylpf)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 24584
NCBI-ProteinID: NP_036737
RGD: 3141
Ensembl: ENSRNOG00000017645
UniProt: P04466
Position
1
AA seq 169 aa
MAPKKAKRRAAAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcacccaagaaggccaagagaagggcagcagcagaagggagctccaatgttttctcc
atgtttgaccagactcagatccaggagttcaaggaggctttcactgtaattgatcagaac
agggatggcattattgacaaggaggatcttcgggacacctttgcggccatgggccgtctc
aatgtgaagaatgaggaactcgacgccatgatgaaggaagccagtgggcctatcaacttc
actgtcttcctgaccatgtttggggagaagctgaagggtgcggaccccgaggatgtgatc
actggagccttcaaggtcctggacccagaagggaagggcaccatcaaaaagcaattcttg
gaggagctgcttaccacgcagtgcgaccgattttcccaggaggagatcaagaatatgtgg
gcagccttccctccagatgtgggcggcaacgtggactacaagaacatctgctatgtcatc
acacacggtgacgctaaggaccaggaatag

KEGG   Rattus norvegicus (rat): 289759
Entry
289759            CDS       T01003                                 

Gene name
Myl7
Definition
(RefSeq) myosin regulatory light chain 2, atrial isoform
  KO
K12754  myosin regulatory light chain 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    289759 (Myl7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    289759 (Myl7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    289759 (Myl7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    289759 (Myl7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    289759 (Myl7)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     289759 (Myl7)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 CHCH
Other DBs
NCBI-GeneID: 289759
NCBI-ProteinID: NP_001099487
RGD: 1308262
Ensembl: ENSRNOG00000014409
UniProt: F1M7K3
Position
14
AA seq 148 aa
MFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQLGRVSVPEEELDAMLQEGKGPINF
TVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLF
ALTPMDLTGNIDYKSLCYIITHGDEKEE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgttcgagcaagcccagattcaggaattcaaggaagccttcagctgcattgaccagaac
agagacggaatcatctgcaagtcagacctgaaggagacttattcccagctcgggagggta
agtgtcccagaggaggagctggatgccatgctgcaagaggggaagggccccatcaacttc
accgtcttcctcacgctcttcggggagaaactcaatgggaccgaccctgaggaggccatc
ctgagtgctttccgaatgtttgacccgagcggccagggagttgtgaacaaggaggagttc
aagcagcttctcatgacccaggcagacaagttctctcctgctgaggtggagcagctgttc
gccctgacacccatggacctgacaggcaacatcgactacaagtctctctgctacatcatc
acccacggggatgagaaagaggagtag

KEGG   Rattus norvegicus (rat): 296313
Entry
296313            CDS       T01003                                 

Gene name
Myl9
Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04270  Vascular smooth muscle contraction
rno04360  Axon guidance
rno04510  Focal adhesion
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    296313 (Myl9)
   04022 cGMP-PKG signaling pathway
    296313 (Myl9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    296313 (Myl9)
   04530 Tight junction
    296313 (Myl9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296313 (Myl9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    296313 (Myl9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    296313 (Myl9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    296313 (Myl9)
  09158 Development and regeneration
   04360 Axon guidance
    296313 (Myl9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    296313 (Myl9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296313 (Myl9)
   04147 Exosome [BR:rno04147]
    296313 (Myl9)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     296313 (Myl9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   296313 (Myl9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 296313
NCBI-ProteinID: NP_001094355
RGD: 1311235
Ensembl: ENSRNOG00000020246
UniProt: Q64122
Position
3
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagagagccaaggccaagaccaccaagaagaggccccagagggctacgtcc
aatgtcttcgctatgtttgaccagtcccagatccaggagtttaaggaggccttcaacatg
attgatcagaaccgtgatggcttcattgacaaggaggacctacatgacatgctggcctcc
ctggggaagaaccccacggatgagtacctggagggtatgatgaacgaggccccgggacct
atcaacttcaccatgttcctcactatgtttggggagaagctgaacggcacagaccccgag
gacgtgatccgcaatgcctttgcctgctttgatgaggaagcctcagggttcatccacgag
gaccacctgcgggagctgctcaccaccatgggcgaccgattcacggatgaggaggtggac
gagatgtaccgtgaggcgcccattgataagaagggcaacttcaactatgtggagttcact
cgcatcctcaagcacggcgccaaggacaaagacgactag

KEGG   Rattus norvegicus (rat): 363925
Entry
363925            CDS       T01003                                 

Gene name
Myl2
Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04371  Apelin signaling pathway
rno04510  Focal adhesion
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
rno05410  Hypertrophic cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    363925 (Myl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    363925 (Myl2)
   04530 Tight junction
    363925 (Myl2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    363925 (Myl2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    363925 (Myl2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    363925 (Myl2)
   04261 Adrenergic signaling in cardiomyocytes
    363925 (Myl2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    363925 (Myl2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    363925 (Myl2)
   05414 Dilated cardiomyopathy
    363925 (Myl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    363925 (Myl2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     363925 (Myl2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11
Other DBs
NCBI-GeneID: 363925
NCBI-ProteinID: NP_001030329
RGD: 1564245
UniProt: P08733
Position
12
AA seq 166 aa
MSPKKAKKRLEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVR
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcaccaaagaaagccaagaagaggttagagggcggaagctccaacgtgttctccatg
tttgagcagacccagatccaggagttcaaggaggccttcacaatcatggaccagaacaga
gacggcttcattgacaagaatgacctaagggacacgtttgctgccctcggacgagtgaac
gtgaaaaacgaagagatcgatgagatgatcaaagaggctccaggtccaattaacttcact
gtgttcctcaccatgtttggggagaaacttaaaggagctgacccggaggagaccattctc
aacgccttcaaggtgtttgaccccgaaggcaaagggtcgctgaaggccgactatgtccgg
gagatgctgaccacgcaagcagagaggttctccaaagaagagatcgaccagatgttcgca
gcttttccccctgacgtcaccggcaaccttgattataagaatttggttcacatcatcacc
cacggagaagagaaggactga

KEGG   Rattus norvegicus (rat): 501203
Entry
501203            CDS       T01003                                 

Gene name
Myl12a
Definition
(RefSeq) myosin regulatory light chain RLC-A
  KO
K12757  myosin regulatory light chain 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04530  Tight junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    501203 (Myl12a)
   04530 Tight junction
    501203 (Myl12a)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    501203 (Myl12a)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    501203 (Myl12a)
   04670 Leukocyte transendothelial migration
    501203 (Myl12a)
  09158 Development and regeneration
   04360 Axon guidance
    501203 (Myl12a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    501203 (Myl12a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    501203 (Myl12a)
   04147 Exosome [BR:rno04147]
    501203 (Myl12a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     501203 (Myl12a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   501203 (Myl12a)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 UPF0154 EF-hand_9 DUF3741 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 501203
NCBI-ProteinID: NP_001128489
RGD: 1309537
Ensembl: ENSRNOG00000015278
UniProt: P13832
Position
9
AA seq 172 aa
MSSKRAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
MGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAIGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaagagcgaagaccaagaccaccaagaagcgccctcagcgcgcaacgtcc
aacgtgttcgccatgtttgaccagtcccagatccaggagttcaaagaggccttcaacatg
atcgaccagaaccgggacggcttcatcgacaaggaggacctgcacgatatgctggcttca
atgggaaaaaatccaactgatgaatacctggacgccatgatgaatgaggccccgggcccc
atcaatttcaccatgttcctcaccatgtttggagaaaagctgaacggcaccgaccctgag
gacgtcatcagaaatgccttcgcttgcttcgatgaggaagcaatcggcaccatccaggag
gattacctgagggagctgctcaccaccatgggcgaccgcttcacagatgaggaagtggat
gagctgtacagggaggcccccatcgacaaaaaggggaatttcaactacatcgagttcacg
cgcatcctcaagcacggagcgaaagacaaagatgactga

KEGG   Rattus norvegicus (rat): 501831
Entry
501831            CDS       T01003                                 

Gene name
Myl10
Definition
(RefSeq) myosin regulatory light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    501831 (Myl10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    501831 (Myl10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    501831 (Myl10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    501831 (Myl10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    501831 (Myl10)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     501831 (Myl10)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 501831
NCBI-ProteinID: XP_038945819
RGD: 1561258
Position
12
AA seq 167 aa
MAPRRARKRVEGTASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI
NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFI
KEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcacccagaagagcccggaagagagtagaaggcacagccagctccaatgtcttctcg
atgtttgaccagtcccagattcaggagtttaaagaggccttcactatcatggaccagaac
cgtgatggcttcattgacaaggaggacctgagggacacctttgctgcactgggtcgcata
aacgtcaagaacgaggagttggaagccatggtgaaggaagctcctgggcccatcaacttc
acagtcttcctgaccatgtttggggagaaactcaagggcacggatccagaagagaccata
ctacatgccttcaaagtatttgatactgaaggaaaaggcttcgtcaaggctgacttcatt
aaggaaaagcttatgacccaggctgaccggttcagtgaggaggaggtcaagcagatgttt
gcggccttcccgccagacgtctgtggcaacttagactacaggaatctgtgctacgttatc
acacacggcgaggagaaggactag

KEGG   Rattus norvegicus (rat): 50685
Entry
50685             CDS       T01003                                 

Gene name
Myl12b
Definition
(RefSeq) myosin regulatory light chain 12B
  KO
K12757  myosin regulatory light chain 12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
rno04510  Focal adhesion
rno04530  Tight junction
rno04611  Platelet activation
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    50685 (Myl12b)
   04530 Tight junction
    50685 (Myl12b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    50685 (Myl12b)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    50685 (Myl12b)
   04670 Leukocyte transendothelial migration
    50685 (Myl12b)
  09158 Development and regeneration
   04360 Axon guidance
    50685 (Myl12b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    50685 (Myl12b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    50685 (Myl12b)
   04147 Exosome [BR:rno04147]
    50685 (Myl12b)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     50685 (Myl12b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   50685 (Myl12b)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 SPARC_Ca_bdg DUF2666 DUF3741 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 50685
NCBI-ProteinID: NP_059039
RGD: 628855
Ensembl: ENSRNOG00000015733
UniProt: P18666 A0A0G2JSW0
Position
9
AA seq 172 aa
MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE
DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtcgagcaaaaaagcaaagaccaagaccaccaaaaagcgccctcagcgcgcaacgtcc
aacgtgttcgccatgtttgaccagtcccagatccaggagttcaaagaggccttcaacatg
atcgaccagaaccgggacggcttcattgacaaggaggacctgcacgacatgctcgcgtct
ctggggaagaaccccaccgacgcctacctggacgccatgatgaacgaggccccgggcccc
atcaatttcaccatgttcctcaccatgtttggagagaagctgaacggcaccgacccagag
gacgtcatcagaaacgccttcgcttgcttcgatgaggaagccacaggcaccatccaggag
gattacctgagggagctgctgaccaccatgggtgaccgcttcacagatgaggaagtggat
gagctgtacagggaggcccccatcgacaaaaagggcaatttcaactacatcgagttcacg
cgcatcctcaagcacggagcgaaagacaaagatgactga

DBGET integrated database retrieval system