KEGG   Rattus norvegicus (rat): 24586Help
Entry
24586             CDS       T01003                                 

Gene name
Ncam1, Cd56, N-CAM, N-CAM-1, NCAM-1, NCAM-C, NCAMC, Ncam
Definition
(RefSeq) neural cell adhesion molecule 1
  KO
K06491  neural cell adhesion molecule
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    24586 (Ncam1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion diseases
    24586 (Ncam1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24586 (Ncam1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    24586 (Ncam1)
   04090 CD molecules [BR:rno04090]
    24586 (Ncam1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24586 (Ncam1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24586 (Ncam1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    24586 (Ncam1)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  NCAM1/2
   24586 (Ncam1)
CD molecules [BR:rno04090]
 Proteins
  24586 (Ncam1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface
   24586 (Ncam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  24586 (Ncam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_5 Izumo-Ig C1-set Ig_6 Adeno_E3_CR1 Collagen_bind_2
Motif
Other DBs
NCBI-GeneID: 24586
NCBI-ProteinID: NP_113709
RGD: 67378
Ensembl: ENSRNOG00000031890
UniProt: P13596
Structure
PDB: 

Position
8q23
AA seq 858 aa AA seqDB search
MLRTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMF
KNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGF
PEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDAS
IHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRP
EKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQ
GPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPD
SENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEPEATGGVP
ILKYKAEWKSLGEEAWHSKWYDAKEANMEGIVTIMGLKPETRYAVRLAALNGKGLGEISA
ATEFKTQPVREPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKYRALASEWKPEI
RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTAGLS
TGAIVGILIVIFVLLLVVMDITCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFS
KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVETKSEPQESEAKPAPTE
VKTVPNEATQTKENESKA
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaactaaggatctcatctggactttgtttttcctgggaactgcagtttccctg
caggtagatattgttcccagccaaggagaaatcagcgttggagagtccaaattcttcctg
tgtcaagtggcaggagatgccaaagataaggacatctcctggttctcccccaacggggag
aaactgagcccaaaccagcagcggatctcagtggtgtggaacgatgatgactcctctacc
ctcaccatctacaacgccaacattgatgatgccggcatttacaagtgcgtggtcaccgct
gaagacggcacccagtccgaggccactgtcaatgtgaagatcttccagaagctcatgttc
aagaatgcgccaaccccacaggagtttaaggaaggggaagatgctgtgattgtctgtgat
gtggtcagctctctgcccccaaccatcatctggaaacacaaaggccgagatgtcatcctg
aaaaaagatgtccggttcatagtcctatccaacaactacctgcagatccgaggcatcaag
aaaacagatgagggcacttaccgctgtgaaggcaggatcctggcccggggggagatcaac
ttcaaggacattcaggtcattgtgaatgtaccacccactgtccaggccagacagagcatc
gtgaatgccactgccaacctgggccagtctgtcaccctggtgtgtgatgccgatggcttc
ccagagcccaccatgagctggacaaaggatggggaacccatagagaatgaggaggaagat
gacgagaagcacatcttcagtgacgacagttcggagctgaccatcaggaatgtggacaaa
aatgacgaagccgaatacgtctgcatcgctgagaacaaggctggcgagcaggatgcctcc
atccacctcaaggtcttcgcaaagcccaaaatcacctatgtagagaatcagacagccatg
gaactagaggagcaagtcactctgacatgtgaagcctccggagaccccattccttccatc
acctggagaacgtccacccgaaacatcagcagtgaagaaaaggcatcgtggactcgacca
gagaagcaagagactctagatgggcacatggtggtacgcagccatgctcgtgtgtcctcc
ctgaccctgaagagcatccagtacacagatgctggagaatacatctgcactgccagcaac
accatcggccaggactcccagtccatgtaccttgaagttcaatatgctcccaagctccag
ggccctgtagctgtgtacacttgggaagggaaccaggtgaacatcacctgtgaggtcttt
gcctacccaagtgccacaatctcctggttccgagatggccagttgctgccaagctccaac
tacagcaatatcaagatctacaacaccccatctgcgagctatctggaggtaacccctgat
tccgaaaatgactttggaaactacaactgcacagcggtgaaccgtattggacaggagtcc
ttggaattcatcctggttcaagcagatacaccatcttccccatccatcgaccgggtggaa
ccatactccagcacagcacaggtacaatttgatgagccagaagccacaggtggagttccc
atcctcaaatacaaggctgagtggaagtcgctgggtgaagaagcatggcattccaagtgg
tatgatgccaaagaagccaacatggaagggattgtcaccatcatgggcctgaagcctgag
acaaggtacgcggtacgactggcggccctcaacggcaaggggctgggcgagatcagtgca
gccactgagttcaagacacagccagtccgggaacccagcgcacccaagctggaagggcag
atgggagaggacgggaactccatcaaggtgaacctgatcaagcaggatgacggcggctcc
cccatcagacactatctggtcaagtacagagcgctcgcctccgagtggaaaccagagatc
aggctcccgtccggcagtgaccacgtcatgctcaagtccctagactggaacgccgagtac
gaagtatatgtggtagctgagaaccagcaaggaaaatccaaggcagctcacttcgtgttc
aggacttcagcccagcccacggccatcccagccaatggcagccccactgcaggcctgagc
acaggcgccattgtgggcatcctcattgtcattttcgtcctactcctggtggtcatggac
atcacctgctacttcctgaacaagtgtggcctgctcatgtgcatcgctgttaacctgtgc
ggcaaagcggggcccggagccaagggcaaagacatggaggagggcaaggctgctttctcg
aaagatgagtctaaagaacccattgtagaggtccgaacggaggaggaacggactccaaac
catgacggagggaagcacacagagcccaacgagaccacaccactgacagagcccgagaag
ggtcctgtagaaacaaagtccgagccccaggagtcagaagcaaagccagcgccaactgaa
gtcaagacggtccccaatgaagccacacaaacgaaagagaatgagagcaaagcatga

DBGET integrated database retrieval system